Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PANK4 is 0.3 ng/ml as a capture antibody.)

Mouse PANK4 Monoclonal Antibody | anti-PANK4 antibody

PANK4 (Pantothenate Kinase 4, DKFZp547M242, FLJ10782) (PE)

Gene Names
PANK4; FLJ10782; DKFZp547M242
Applications
ELISA
Purity
Purified
Synonyms
PANK4; Monoclonal Antibody; PANK4 (Pantothenate Kinase 4; DKFZp547M242; FLJ10782) (PE); Pantothenate Kinase 4; FLJ10782; anti-PANK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C1
Specificity
Recognizes PANK4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PANK4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PANK4 (NP_060686.1, 673aa-773aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PANK4 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PANK4 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-PANK4 antibody
This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. This family member is most abundant in muscle but is expressed in all tissues. [provided by RefSeq]
Product Categories/Family for anti-PANK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,991 Da
NCBI Official Full Name
pantothenate kinase 4
NCBI Official Synonym Full Names
pantothenate kinase 4
NCBI Official Symbol
PANK4
NCBI Official Synonym Symbols
FLJ10782; DKFZp547M242
NCBI Protein Information
pantothenate kinase 4; hPanK4; OTTHUMP00000000865; OTTHUMP00000220861; OTTHUMP00000220862; pantothenic acid kinase 4
UniProt Protein Name
Pantothenate kinase 4
Protein Family
UniProt Gene Name
PANK4
UniProt Synonym Gene Names
hPanK4

Uniprot Description

Plays a role in the physiological regulation of the intracellular CoA concentration.

Similar Products

Product Notes

The PANK4 pank4 (Catalog #AAA6186566) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PANK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PANK4 pank4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PANK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.