Mouse anti-Human PAK4 Monoclonal Antibody | anti-PAK4 antibody

PAK4 (Serine/Threonine-protein Kinase PAK 4, p21-activated Kinase 4, PAK-4, KIAA1142) (HRP)

Cat. Num. AAA6153961

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAK4; Monoclonal Antibody; PAK4 (Serine/Threonine-protein Kinase PAK 4; p21-activated Kinase 4; PAK-4; KIAA1142) (HRP); anti-PAK4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F10
• Specificity: Recognizes human PAK4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PAK4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa68-157 from PAK4 (AAH02921) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Related Product Information for anti-PAK4 antibody

P21-activated kinases (PAKs) belong to the family of serine/threonine kinases involved in the control of various cellular processes, including the cell cycle, dynamics of the cytoskeleton, apoptosis, oncogenic transformation, and transcription. All PAK family members are characterized by the presence of p21-binding domain. p21-activated kinases are regulated by the small GTP-binding proteins Rac and Cdc42, and lipids, which stimulate autophosphorylation and phosphorylation of exogenous substrates. Serine (Ser-474) is the likely autophosphorylation site in the kinase domain of PAK4 in vivo. Phosphospecific antibodies directed against serine 474 detect activated PAK4 on the Golgi membrane when PAK4 is co-expressed with activated Cdc42. Current data strongly implicates PAK-4 in oncogenesis. PAK4 is frequently overexpressed in human tumor cell lines of various tissue origins.

Product Categories/Family for anti-PAK4 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33877350
• NCBI GeneID: 10298
• Molecular Weight: 54,940 Da
• NCBI Official Full Name: Homo sapiens p21 protein (Cdc42/Rac)-activated kinase 4, mRNA
• NCBI Official Synonym Full Names: p21 (RAC1) activated kinase 4
• NCBI Official Symbol: PAK4
• NCBI Protein Information: serine/threonine-protein kinase PAK 4
• Protein Family: Serine/threonine-protein kinase

NCBI Description

PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]