Mouse anti-Human PAFAH2 Monoclonal Antibody | anti-PAFAH2 antibody

PAFAH2 (Platelet-activating Factor Acetylhydrolase 2, Cytoplasmic, Serine-dependent Phospholipase A2, FLJ26025) (FITC)

Cat. Num. AAA6148649

• Gene Names: PAFAH2; HSD-PLA2
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAFAH2; Monoclonal Antibody; PAFAH2 (Platelet-activating Factor Acetylhydrolase 2; Cytoplasmic; Serine-dependent Phospholipase A2; FLJ26025) (FITC); anti-PAFAH2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A8
• Specificity: Recognizes human PAFAH2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PAFAH2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa293-393 from human PAFAH2 (NP_000428) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PAFAH2 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-PAFAH2 antibody

This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme.

Product Categories/Family for anti-PAFAH2 antibody

Antibodies; Enzymes; Phospholipase

NCBI and Uniprot Product Information

• NCBI GI #: 4758878
• NCBI GeneID: 5051
• NCBI Accession #: NP_000428
• NCBI GenBank Nucleotide #: NM_000437
• UniProt Accession #: Q99487; O15458; Q5SY02; D3DPK1
• Molecular Weight: 46.4kDa (415aa) confirmed by MALDI-TOF
• NCBI Official Full Name: platelet-activating factor acetylhydrolase 2, cytoplasmic
• NCBI Official Synonym Full Names: platelet activating factor acetylhydrolase 2
• NCBI Official Symbol: PAFAH2
• NCBI Official Synonym Symbols: HSD-PLA2
• NCBI Protein Information: platelet-activating factor acetylhydrolase 2, cytoplasmic
• UniProt Protein Name: Platelet-activating factor acetylhydrolase 2, cytoplasmic
• Protein Family: Platelet-activating factor acetylhydrolase
• UniProt Gene Name: PAFAH2
• UniProt Synonym Gene Names: SD-PLA2; hSD-PLA2
• UniProt Entry Name: PAFA2_HUMAN

NCBI Description

This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. [provided by RefSeq, Jul 2008]

Uniprot Description

PAFAH2: Has a marked selectivity for phospholipids with short acyl chains at the sn-2 position. May share a common physiologic function with the plasma-type enzyme. Belongs to the serine esterase family.

Protein type: EC 3.1.1.47; Hydrolase; Lipid Metabolism - ether lipid; Lipid-binding

Chromosomal Location of Human Ortholog: 1p36

Molecular Function: 1-alkyl-2-acetylglycerophosphocholine esterase activity; phospholipid binding

Biological Process: lipid metabolic process