Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human PAFAH1B1 Monoclonal Antibody | anti-PAFAH1B1 antibody

PAFAH1B1 (Platelet-activating Factor Acetylhydrolase IB Subunit alpha, Lissencephaly-1 Protein, LIS-1, PAF Acetylhydrolase 45kD Subunit, PAF-AH 45kD Subunit, PAF-AH alpha, PAFAH alpha, LIS1, MDCR, MDS, PAFAHA) (PE)

Gene Names
PAFAH1B1; MDS; LIS1; LIS2; MDCR; NudF; PAFAH
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAFAH1B1; Monoclonal Antibody; PAFAH1B1 (Platelet-activating Factor Acetylhydrolase IB Subunit alpha; Lissencephaly-1 Protein; LIS-1; PAF Acetylhydrolase 45kD Subunit; PAF-AH 45kD Subunit; PAF-AH alpha; PAFAH alpha; LIS1; MDCR; MDS; PAFAHA) (PE); anti-PAFAH1B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C12
Specificity
Recognizes human PAFAH1B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PAFAH1B1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human PAFAH1B1 (NP_000421) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged PAFAH1B1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PAFAH1B1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PAFAH1B1 antibody
Required for proper activation of Rho GTPases and actin polymerization at the leading edge of locomoting cerebellar neurons and postmigratory hippocampal neurons in response to calcium influx triggered via NMDA receptors. Non-catalytic subunit of an acetylhydrolase complex which inactivates platelet-activating factor (PAF) by removing the acetyl group at the SN-2 position (By similarity). Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuronal migration involves a process called nucleokinesis, whereby migrating cells extend an anterior process into which the nucleus subsequently translocates. During nucleokinesis dynein at the nuclear surface may translocate the nucleus towards the centrosome by exerting force on centrosomal microtubules. May also play a role in other forms of cell locomotion including the migration of fibroblasts during wound healing.
Product Categories/Family for anti-PAFAH1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
platelet-activating factor acetylhydrolase IB subunit alpha
NCBI Official Synonym Full Names
platelet activating factor acetylhydrolase 1b regulatory subunit 1
NCBI Official Symbol
PAFAH1B1
NCBI Official Synonym Symbols
MDS; LIS1; LIS2; MDCR; NudF; PAFAH
NCBI Protein Information
platelet-activating factor acetylhydrolase IB subunit alpha
UniProt Protein Name
Platelet-activating factor acetylhydrolase IB subunit alpha
UniProt Gene Name
PAFAH1B1
UniProt Entry Name
LIS1_HUMAN

NCBI Description

This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. [provided by RefSeq, Apr 2009]

Uniprot Description

PAFAH1B1: Required for proper activation of Rho GTPases and actin polymerization at the leading edge of locomoting cerebellar neurons and postmigratory hippocampal neurons in response to calcium influx triggered via NMDA receptors. Non-catalytic subunit of an acetylhydrolase complex which inactivates platelet- activating factor (PAF) by removing the acetyl group at the SN-2 position. Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuronal migration involves a process called nucleokinesis, whereby migrating cells extend an anterior process into which the nucleus subsequently translocates. During nucleokinesis dynein at the nuclear surface may translocate the nucleus towards the centrosome by exerting force on centrosomal microtubules. May also play a role in other forms of cell locomotion including the migration of fibroblasts during wound healing. Defects in PAFAH1B1 are the cause of lissencephaly type 1 (LIS1); also known as classic lissencephaly. LIS1 is characterized by agyria or pachgyria and disorganization of the clear neuronal lamination of normal six-layered cortex. The cortex is abnormally thick and poorly organized with 4 primitive layers. LIS1 is associated with enlarged and dysmorphic ventricles and often hypoplasia of the corpus callosum. Defects in PAFAH1B1 are the cause of subcortical band heterotopia (SBH). SBH is a mild brain malformation of the lissencephaly spectrum. It is characterized by bilateral and symmetric ribbons of gray matter found in the central white matter between the cortex and the ventricular surface. Defects in PAFAH1B1 are a cause of Miller-Dieker lissencephaly syndrome (MDLS). MDLS is a contiguous gene deletion syndrome of chromosome 17p13.3, characterized by classical lissencephaly and distinct facial features. Additional congenital malformations can be part of the condition. Belongs to the WD repeat LIS1/nudF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Lipid Metabolism - ether lipid

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: astral microtubule; centrosome; nuclear membrane; leading edge; nuclear envelope; cell cortex; cytosol; kinetochore; kinesin complex; microtubule associated complex; growth cone; cell soma; axon; perinuclear region of cytoplasm; motile primary cilium

Molecular Function: heparin binding; dynein binding; protein binding; protein homodimerization activity; phospholipase binding; microtubule binding; dynein intermediate chain binding; phosphoprotein binding

Biological Process: acrosome formation; negative regulation of JNK cascade; platelet activating factor metabolic process; adult locomotory behavior; stem cell division; positive regulation of axon extension; protein secretion; neuron migration; positive regulation of mitotic cell cycle; retrograde axon cargo transport; microtubule-based process; cerebral cortex neuron differentiation; synaptic transmission; learning and/or memory; establishment of centrosome localization; establishment of mitotic spindle orientation; vesicle transport along microtubule; brain morphogenesis; G2/M transition of mitotic cell cycle; neuromuscular process controlling balance; layer formation in the cerebral cortex; microtubule organizing center organization and biogenesis; mitosis; organelle organization and biogenesis; corpus callosum morphogenesis; hippocampus development; transmission of nerve impulse; nuclear envelope disassembly; microtubule cytoskeleton organization and biogenesis; ameboidal cell migration; neuroblast proliferation; cerebral cortex development; mitotic cell cycle; actin cytoskeleton organization and biogenesis; positive regulation of cytokine and chemokine mediated signaling pathway; nuclear migration; lipid catabolic process

Disease: Lissencephaly 1

Research Articles on PAFAH1B1

Similar Products

Product Notes

The PAFAH1B1 pafah1b1 (Catalog #AAA6159253) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAFAH1B1 (Platelet-activating Factor Acetylhydrolase IB Subunit alpha, Lissencephaly-1 Protein, LIS-1, PAF Acetylhydrolase 45kD Subunit, PAF-AH 45kD Subunit, PAF-AH alpha, PAFAH alpha, LIS1, MDCR, MDS, PAFAHA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAFAH1B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAFAH1B1 pafah1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAFAH1B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.