Mouse ORC3L Monoclonal Antibody | anti-ORC3L antibody

ORC3L (Origin Recognition Complex, Subunit 3-like (yeast), LAT, LATHEO, ORC3) (AP)

Cat. Num. AAA6163922

• Gene Names: ORC3; LAT; ORC3L; LATHEO
• Applications: ELISA
• Purity: Purified
• Synonyms: ORC3L; Monoclonal Antibody; ORC3L (Origin Recognition Complex; Subunit 3-like (yeast); LAT; LATHEO; ORC3) (AP); Origin Recognition Complex; ORC3; anti-ORC3L antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G1
• Specificity: Recognizes ORC3L.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 711

• Applicable Applications for anti-ORC3L antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ORC3L (AAH35494, 602aa-711aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ORC3L is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-ORC3L antibody

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Studies of a similar gene in Drosophila suggested a possible role of this protein in neuronal proliferation and olfactory memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene. [provided by RefSeq]

Product Categories/Family for anti-ORC3L antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 32425468
• NCBI GeneID: 23595
• NCBI Official Full Name: Origin recognition complex, subunit 3-like (yeast)
• NCBI Official Synonym Full Names: origin recognition complex subunit 3
• NCBI Official Symbol: ORC3
• NCBI Official Synonym Symbols: LAT; ORC3L; LATHEO
• NCBI Protein Information: origin recognition complex subunit 3

NCBI Description

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Studies of a similar gene in Drosophila suggested a possible role of this protein in neuronal proliferation and olfactory memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008]