Mouse OPA1 Monoclonal Antibody | anti-OPA1 antibody

OPA1 (Pptic Atrophy 1 (Autosomal Dominant), FLJ12460, KIAA0567, MGM1, NPG, NTG, LargeG) (AP)

Cat. Num. AAA6164788

• Gene Names: OPA1; NPG; NTG; MGM1; BERHS; largeG; MTDPS14
• Applications: ELISA
• Purity: Purified
• Synonyms: OPA1; Monoclonal Antibody; OPA1 (Pptic Atrophy 1 (Autosomal Dominant); FLJ12460; KIAA0567; MGM1; NPG; NTG; LargeG) (AP); Pptic Atrophy 1 (Autosomal Dominant); LargeG; anti-OPA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C10
• Specificity: Recognizes OPA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 960

• Applicable Applications for anti-OPA1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: OPA1 (NP_056375, 851aa-960aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged OPA1 is 1 ng/ml as a capture antibody.)

Related Product Information for anti-OPA1 antibody

This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-OPA1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 224831243
• NCBI GeneID: 4976
• NCBI Accession #: NP_056375
• NCBI GenBank Nucleotide #: NP_056375.2
• UniProt Accession #: O60313
• NCBI Official Full Name: dynamin-like 120 kDa protein, mitochondrial isoform 1 preproprotein
• NCBI Official Synonym Full Names: OPA1 mitochondrial dynamin like GTPase
• NCBI Official Symbol: OPA1
• NCBI Official Synonym Symbols: NPG; NTG; MGM1; BERHS; largeG; MTDPS14
• NCBI Protein Information: dynamin-like 120 kDa protein, mitochondrial
• UniProt Protein Name: Dynamin-like 120 kDa protein, mitochondrial
• Protein Family: Dynamin-like 120 kDa protein
• UniProt Gene Name: OPA1
• UniProt Synonym Gene Names: KIAA0567
• UniProt Entry Name: OPA1_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. The encoded protein localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. [provided by RefSeq, Aug 2017]

Uniprot Description

OPA1: a dynamin-related GTPase required for mitochondrial fusion and regulation of apoptosis. May form a diffusion barrier for proteins stored in mitochondrial cristae. Proteolytic processing in response to intrinsic apoptotic signals may lead to disassembly of OPA1 oligomers and release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space. Defects in OPA1 are the cause of optic atrophy 1 and deafness. Eight splice-variant isoforms have been described.

Protein type: Membrane protein, integral; Hydrolase; Mitochondrial; Apoptosis; EC 3.6.5.5

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: cytoplasm; dendrite; integral to membrane; membrane; mitochondrial crista; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial outer membrane; mitochondrion; nucleoplasm

Molecular Function: GTP binding; GTPase activity; magnesium ion binding; protein binding

Biological Process: apoptosis; axon transport of mitochondrion; inner mitochondrial membrane organization and biogenesis; metabolic process; mitochondrial fission; mitochondrial fusion; mitochondrial genome maintenance; mitochondrion organization and biogenesis; positive regulation of neuron maturation; visual perception

Disease: Glaucoma, Normal Tension, Susceptibility To; Optic Atrophy 1; Optic Atrophy With Or Without Deafness, Ophthalmoplegia, Myopathy, Ataxia, And Neuropathy