Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human NUP43 Monoclonal Antibody | anti-NUP43 antibody

NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42)

Gene Names
NUP43; p42; bA350J20.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NUP43; Monoclonal Antibody; NUP43 (Nucleoporin Nup43; Nup107-160 Subcomplex Subunit Nup43; p42; FLJ13287; bA350J20.1; p42); Anti -NUP43 (Nucleoporin Nup43; anti-NUP43 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G5
Specificity
Recognizes human NUP43.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS*
Applicable Applications for anti-NUP43 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant protein corresponding to aa281-381 from human NUP43 with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody.|Lane 1: NUP43 transfected lysate (42.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody.|Lane 1: NUP43 transfected lysate (42.2kD).|Lane 2: Non-transfected lysate.)
Related Product Information for anti-NUP43 antibody
NUP43 probably mediates the assembly of subdomains of the nuclear pore complex (NPC) or facilitates the interaction of transport complexes with the NPC.
Product Categories/Family for anti-NUP43 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,151 Da
NCBI Official Full Name
nucleoporin Nup43
NCBI Official Synonym Full Names
nucleoporin 43kDa
NCBI Official Symbol
NUP43
NCBI Official Synonym Symbols
p42; bA350J20.1
NCBI Protein Information
nucleoporin Nup43; nup107-160 subcomplex subunit Nup43
UniProt Protein Name
Nucleoporin Nup43
Protein Family
UniProt Gene Name
NUP43
UniProt Entry Name
NUP43_HUMAN

NCBI Description

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM, Mar 2008]

Uniprot Description

NUP43: Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Protein type: Cell cycle regulation; Nucleoporin

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: kinetochore; nuclear envelope; cytosol

Molecular Function: protein binding

Biological Process: mitosis; protein transport; mRNA transport; viral reproduction; cell division; cytokine and chemokine mediated signaling pathway; hexose transport; carbohydrate metabolic process; mitotic nuclear envelope disassembly; gene expression; pathogenesis; viral transcription; viral infectious cycle; mitotic cell cycle; glucose transport; transmembrane transport; chromosome segregation

Similar Products

Product Notes

The NUP43 nup43 (Catalog #AAA6003685) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUP43 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the NUP43 nup43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SEDGSLWHWD ASTDVPEKSS LFHQGGRSST FLSHSISNQA NVHQSVISSW LSTDPAKDRI EITSLLPSRS LSVNTLDVLG PCLVCGTDAE AIYVTRHLFS *. It is sometimes possible for the material contained within the vial of "NUP43, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.