Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.51kD).)

Mouse anti-Human NUMA1 Monoclonal Antibody | anti-NUMA1 antibody

NUMA1 (Nuclear Mitotic Apparatus Protein 1, NuMA Protein, SP-H Antigen, NUMA) (FITC)

Gene Names
NUMA1; NUMA; NMP-22
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUMA1; Monoclonal Antibody; NUMA1 (Nuclear Mitotic Apparatus Protein 1; NuMA Protein; SP-H Antigen; NUMA) (FITC); anti-NUMA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C5
Specificity
Recognizes human NUMA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NUMA1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa200-307 from human NUMA1 (NP_006176) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.51kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.51kD).)

Western Blot (WB)

(NUMA1 monoclonal antibody. Western Blot analysis of NUMA1 expression in K-562)

Western Blot (WB) (NUMA1 monoclonal antibody. Western Blot analysis of NUMA1 expression in K-562)

Immunoprecipitation (IP)

(Immunoprecipitation of NUMA1 transfected lysate using NUMA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NUMA1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NUMA1 transfected lysate using NUMA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NUMA1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged NUMA1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NUMA1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NUMA1 antibody
NuMA (nuclear mitotic apparatus) is a long coil-coiled protein that plays a role in the interphase and mitosis phases of a cell cycle. In interphase, it has been hypothesized to play a structural role in the nucleoskeleton that may be important in nuclear organization and functions. During mitosis, it is associated with spindle microtubule organization and chromosome positioning. Therefore, this antibody is useful as a cell cycle marker.
Product Categories/Family for anti-NUMA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,279 Da
NCBI Official Full Name
nuclear mitotic apparatus protein 1 isoform 1
NCBI Official Synonym Full Names
nuclear mitotic apparatus protein 1
NCBI Official Symbol
NUMA1
NCBI Official Synonym Symbols
NUMA; NMP-22
NCBI Protein Information
nuclear mitotic apparatus protein 1; SP-H antigen; centrophilin stabilizes mitotic spindle in mitotic cells; nuclear matrix protein-22; structural nuclear protein
UniProt Protein Name
Nuclear mitotic apparatus protein 1
UniProt Gene Name
NUMA1
UniProt Synonym Gene Names
NUMA; NuMA protein
UniProt Entry Name
NUMA1_HUMAN

Uniprot Description

NuMA-1: a coiled-coil nuclear protein that is required to establish and maintain mammalian spindle poles. Dissociates from condensing chromosomes during early prophase, before the complete disintegration of the nuclear lamina. As mitosis progresses it reassociates with telophase chromosomes very early during nuclear reformation, before substantial accumulation of lamins on chromosomal surfaces is evident. Two human splice-variant isoforms have been described.

Protein type: Cell cycle regulation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: spindle pole; nuclear matrix; dendrite; chromosome; cytosol; nucleoplasm; Golgi membrane; cell soma; apical part of cell; spindle microtubule; cytoplasm; spindle; nucleus

Molecular Function: protein binding; microtubule binding; structural molecule activity

Biological Process: mitosis; meiotic cell cycle; establishment of mitotic spindle orientation; cell division; mitotic cell cycle; G2/M transition of mitotic cell cycle; nuclear organization and biogenesis

Disease: Acute Promyelocytic Leukemia

Similar Products

Product Notes

The NUMA1 numa1 (Catalog #AAA6148591) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NUMA1 (Nuclear Mitotic Apparatus Protein 1, NuMA Protein, SP-H Antigen, NUMA) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUMA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUMA1 numa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUMA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.