Testing Data
(Detection limit for recombinant GST tagged NUDT2 is approximately 1ng/ml as a capture antibody.)
Mouse NUDT2 Monoclonal Antibody | anti-NUDT2 antibody
NUDT2 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 2, APAH1, MGC10404) (APC)
Gene Names
NUDT2; APAH1
Applications
Western Blot
Purity
Purified
Synonyms
NUDT2; Monoclonal Antibody; NUDT2 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 2; APAH1; MGC10404) (APC); Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 2; MGC10404; anti-NUDT2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
S1
Specificity
Recognizes NUDT2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
147
Applicable Applications for anti-NUDT2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NUDT2 (AAH04926, 1aa-147aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged NUDT2 is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NUDT2 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-NUDT2 antibody
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq]
Product Categories/Family for anti-NUDT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Nudix (nucleoside diphosphate linked moiety X)-type motif 2
NCBI Official Synonym Full Names
nudix hydrolase 2
NCBI Official Symbol
NUDT2
NCBI Official Synonym Symbols
APAH1
NCBI Protein Information
bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
Protein Family
NCBI Description
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]
Research Articles on NUDT2
Similar Products
Product Notes
The NUDT2 (Catalog #AAA6168156) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NUDT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUDT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUDT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
