Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M02), clone 1B9.Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).Lane 2: Non-transfected lysate.)

Mouse NRF1 Monoclonal Antibody | anti-NRF1 antibody

NRF1 (Nuclear Respiratory Factor 1, ALPHA-PAL) (Biotin)

Gene Names
NRF1; ALPHA-PAL
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NRF1; Monoclonal Antibody; NRF1 (Nuclear Respiratory Factor 1; ALPHA-PAL) (Biotin); Nuclear Respiratory Factor 1; ALPHA-PAL; anti-NRF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Specificity
Recognizes NRF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NRF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NRF1 (NP_005002, 201aa-285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M02), clone 1B9.Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M02), clone 1B9.Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-NRF1 antibody
This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1. [provided by RefSeq]
Product Categories/Family for anti-NRF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
nuclear respiratory factor 1 isoform 1
NCBI Official Synonym Full Names
nuclear respiratory factor 1
NCBI Official Symbol
NRF1
NCBI Official Synonym Symbols
ALPHA-PAL
NCBI Protein Information
nuclear respiratory factor 1
UniProt Protein Name
Nuclear respiratory factor 1
UniProt Gene Name
NRF1
UniProt Synonym Gene Names
NRF-1; Alpha-pal
UniProt Entry Name
NRF1_HUMAN

NCBI Description

This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternative splicing results in multiple transcript variants. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1. [provided by RefSeq, May 2014]

Uniprot Description

NRF1: Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. Belongs to the NRF1/Ewg family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 7q32

Cellular Component: nucleoplasm; cytoplasm

Biological Process: regulation of transcription from RNA polymerase II promoter; mitochondrion organization and biogenesis; organ regeneration; generation of precursor metabolites and energy; transcription, DNA-dependent; response to folic acid; organelle organization and biogenesis; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; response to lipopolysaccharide; cellular lipid metabolic process; response to electrical stimulus; response to estradiol stimulus

Research Articles on NRF1

Similar Products

Product Notes

The NRF1 nrf1 (Catalog #AAA6173915) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NRF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NRF1 nrf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NRF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.