Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human NR3C1 Monoclonal Antibody | anti-NR3C1 antibody

NR3C1 (Glucocorticoid Receptor, GR, Nuclear Receptor Subfamily 3 Group C Member 1, GRL) APC

Gene Names
NR3C1; GR; GCR; GRL; GCCR; GCRST
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR3C1; Monoclonal Antibody; NR3C1 (Glucocorticoid Receptor; GR; Nuclear Receptor Subfamily 3 Group C Member 1; GRL) APC; anti-NR3C1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C8
Specificity
Recognizes human NR3C1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NR3C1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-140 from human NR3C1 (AAH15610) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(NR3C1 monoclonal antibody. Western Blot analysis of NR3C1 expression in HeLa.)

Western Blot (WB) (NR3C1 monoclonal antibody. Western Blot analysis of NR3C1 expression in HeLa.)

Western Blot (WB)

(NR3C1 monoclonal antibody, Western Blot analysis of NR3C1 expression in HeLa NE.)

Western Blot (WB) (NR3C1 monoclonal antibody, Western Blot analysis of NR3C1 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of NR3C1 expression in transfected 293T cell line by NR3C1 monoclonal antibody. Lane 1: NR3C1 transfected lysate (85.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NR3C1 expression in transfected 293T cell line by NR3C1 monoclonal antibody. Lane 1: NR3C1 transfected lysate (85.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NR3C1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NR3C1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NR3C1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NR3C1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-NR3C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
49,802 Da
NCBI Official Full Name
Homo sapiens nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor), mRNA
NCBI Official Synonym Full Names
nuclear receptor subfamily 3 group C member 1
NCBI Official Symbol
NR3C1
NCBI Official Synonym Symbols
GR; GCR; GRL; GCCR; GCRST
NCBI Protein Information
glucocorticoid receptor
Protein Family

NCBI Description

This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other transcription factors. This receptor is typically found in the cytoplasm, but upon ligand binding, is transported into the nucleus. It is involved in inflammatory responses, cellular proliferation, and differentiation in target tissues. Mutations in this gene are associated with generalized glucocorticoid resistance. Alternative splicing of this gene results in transcript variants encoding either the same or different isoforms. Additional isoforms resulting from the use of alternate in-frame translation initiation sites have also been described, and shown to be functional, displaying diverse cytoplasm-to-nucleus trafficking patterns and distinct transcriptional activities (PMID:15866175). [provided by RefSeq, Feb 2011]

Research Articles on NR3C1

Similar Products

Product Notes

The NR3C1 (Catalog #AAA6137953) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR3C1 (Glucocorticoid Receptor, GR, Nuclear Receptor Subfamily 3 Group C Member 1, GRL) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR3C1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR3C1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR3C1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.