Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NR1D1 Monoclonal Antibody | anti-NR1D1 antibody

NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1, EAR1, THRA1, THRAL, ear-1, hRev) (MaxLight 650)

Gene Names
NR1D1; EAR1; hRev; THRA1; THRAL; ear-1
Applications
Western Blot
Purity
Purified
Synonyms
NR1D1; Monoclonal Antibody; NR1D1 (Nuclear Receptor Subfamily 1; Group D; Member 1; EAR1; THRA1; THRAL; ear-1; hRev) (MaxLight 650); Nuclear Receptor Subfamily 1; hRev; anti-NR1D1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C2
Specificity
Recognizes NR1D1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-NR1D1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NR1D1 (NP_068370, 233aa-322aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASG
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NR1D1 antibody
Mouse monoclonal antibody raised against a full-length recombinant NR1D1.
Product Categories/Family for anti-NR1D1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,805 Da
NCBI Official Full Name
nuclear receptor subfamily 1 group D member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1, group D, member 1
NCBI Official Symbol
NR1D1
NCBI Official Synonym Symbols
EAR1; hRev; THRA1; THRAL; ear-1
NCBI Protein Information
nuclear receptor subfamily 1 group D member 1; Rev-ErbAalpha; V-erbA-related protein 1; nuclear receptor Rev-ErbA-alpha; rev-erbA-alpha
UniProt Protein Name
Nuclear receptor subfamily 1 group D member 1
UniProt Gene Name
NR1D1
UniProt Synonym Gene Names
EAR1; HREV; THRAL; EAR-1
UniProt Entry Name
NR1D1_HUMAN

Uniprot Description

NR1D1: a widely expressed member of the orphan nuclear receptor family of proteins. Expressed at relatively high levels in adipose tissue, skeletal muscle, brain and liver, and regulates cellular proliferation and differentiation. Expression increases during differentiation in adipocytes and its ectopic expression in 3T3-L1 cells potentiates adipocyte differentiation. A metabolic regulator whose expression is increased in HER2-positive breast cancer cells. Regulates malate dehydrogenase 1 (MDH1) and malic enzyme 1 (ME1), enzymes that link glycolysis and fatty acid synthesis. May contribute to the abnormal cellular energy metabolism observed in HER2-positive breast cancers. Its expression oscillates with circadian rhythm in liver cells, regulating the expression of BMAL1, ApoA1 and ApoC3, all key regulators of circadian rhythm. Represses the basal activity of the mouse Bmal1 gene promoter. Phosphorylation by GSK3b at S55/59 stabilizes NRD1 protein levels. Regulates inflammation by targeting the NF-??B responsive genes IL-6 and COX-2. NR1D1 lacks the activation function 2 domain required for ligand-dependent activation of transcription by other members of the nuclear receptor family; thus it behaves as a constitutive repressor protein, recruiting the nuclear receptor co-repressor N-CoR1/HDAC3 complex to target genes to repress transcription.

Protein type: Nuclear receptor; Transcription factor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; nuclear chromatin; dendrite; cytoplasm; dendritic spine; nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; zinc ion binding; heme binding; steroid hormone receptor activity; transcription corepressor activity

Biological Process: proteasomal protein catabolic process; circadian rhythm; circadian thermoregulation; transcription initiation from RNA polymerase II promoter; glycogen biosynthetic process; intracellular receptor-mediated signaling pathway; regulation of lipid metabolic process; regulation of fat cell differentiation; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; regulation of circadian rhythm; negative regulation of toll-like receptor 4 signaling pathway; gene expression; steroid hormone mediated signaling; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent; cell differentiation

Similar Products

Product Notes

The NR1D1 nr1d1 (Catalog #AAA6229008) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NR1D1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR1D1 nr1d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR1D1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.