Mouse NR1D1 Monoclonal Antibody | anti-NR1D1 antibody

NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1, EAR1, THRA1, THRAL, ear-1, hRev) (HRP)

Cat. Num. AAA6182091

• Gene Names: NR1D1; EAR1; hRev; THRA1; THRAL; ear-1
• Applications: Western Blot
• Purity: Purified
• Synonyms: NR1D1; Monoclonal Antibody; NR1D1 (Nuclear Receptor Subfamily 1; Group D; Member 1; EAR1; THRA1; THRAL; ear-1; hRev) (HRP); Nuclear Receptor Subfamily 1; hRev; anti-NR1D1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G5
• Specificity: Recognizes NR1D1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NR1D1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NR1D1 (NP_068370, 233aa-322aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NR1D1 monoclonal antibody (M17), clone 3G5. Western Blot analysis of NR1D1 expression in human kidney.)

Western Blot (WB)

(NR1D1 monoclonal antibody (M17), clone 3G5. Western Blot analysis of NR1D1 expression in human skeletal muscle.)

Product Categories/Family for anti-NR1D1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 13430848
• NCBI GeneID: 9572
• NCBI Accession #: NP_068370
• NCBI GenBank Nucleotide #: NM_021724
• UniProt Accession #: P20393; Q0P5Z4; Q15304
• Molecular Weight: 66,805 Da
• NCBI Official Full Name: nuclear receptor subfamily 1 group D member 1
• NCBI Official Synonym Full Names: nuclear receptor subfamily 1, group D, member 1
• NCBI Official Symbol: NR1D1
• NCBI Official Synonym Symbols: EAR1; hRev; THRA1; THRAL; ear-1
• NCBI Protein Information: nuclear receptor subfamily 1 group D member 1; Rev-ErbAalpha; V-erbA-related protein 1; nuclear receptor Rev-ErbA-alpha; rev-erbA-alpha
• UniProt Protein Name: Nuclear receptor subfamily 1 group D member 1
• Protein Family: Nuclear receptor subfamily
• UniProt Gene Name: NR1D1
• UniProt Synonym Gene Names: EAR1; HREV; THRAL; EAR-1
• UniProt Entry Name: NR1D1_HUMAN

Uniprot Description

NR1D1: a widely expressed member of the orphan nuclear receptor family of proteins. Expressed at relatively high levels in adipose tissue, skeletal muscle, brain and liver, and regulates cellular proliferation and differentiation. Expression increases during differentiation in adipocytes and its ectopic expression in 3T3-L1 cells potentiates adipocyte differentiation. A metabolic regulator whose expression is increased in HER2-positive breast cancer cells. Regulates malate dehydrogenase 1 (MDH1) and malic enzyme 1 (ME1), enzymes that link glycolysis and fatty acid synthesis. May contribute to the abnormal cellular energy metabolism observed in HER2-positive breast cancers. Its expression oscillates with circadian rhythm in liver cells, regulating the expression of BMAL1, ApoA1 and ApoC3, all key regulators of circadian rhythm. Represses the basal activity of the mouse Bmal1 gene promoter. Phosphorylation by GSK3b at S55/59 stabilizes NRD1 protein levels. Regulates inflammation by targeting the NF-??B responsive genes IL-6 and COX-2. NR1D1 lacks the activation function 2 domain required for ligand-dependent activation of transcription by other members of the nuclear receptor family; thus it behaves as a constitutive repressor protein, recruiting the nuclear receptor co-repressor N-CoR1/HDAC3 complex to target genes to repress transcription.

Protein type: Nuclear receptor; Transcription factor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; nuclear chromatin; dendrite; cytoplasm; dendritic spine; nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; zinc ion binding; heme binding; steroid hormone receptor activity; transcription corepressor activity

Biological Process: proteasomal protein catabolic process; circadian rhythm; circadian thermoregulation; transcription initiation from RNA polymerase II promoter; glycogen biosynthetic process; intracellular receptor-mediated signaling pathway; regulation of lipid metabolic process; regulation of fat cell differentiation; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; regulation of circadian rhythm; negative regulation of toll-like receptor 4 signaling pathway; gene expression; steroid hormone mediated signaling; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent; cell differentiation