Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of NPC2 transfected lysate using anti-NPC2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NPC2 MaxPab rabbit polyclonal antibody.)

Mouse NPC2 Monoclonal Antibody | anti-NPC2 antibody

NPC2 (Niemann-Pick Disease, Type C2, HE1, MGC1333, NP-C2) (Biotin)

Gene Names
NPC2; HE1; EDDM1
Applications
Immunoprecipitation
Purity
Purified
Synonyms
NPC2; Monoclonal Antibody; NPC2 (Niemann-Pick Disease; Type C2; HE1; MGC1333; NP-C2) (Biotin); Niemann-Pick Disease; NP-C2; anti-NPC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F4
Specificity
Recognizes NPC2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NPC2 antibody
Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NPC2 (NP_006423.1, 52aa-151aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of NPC2 transfected lysate using anti-NPC2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NPC2 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NPC2 transfected lysate using anti-NPC2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NPC2 MaxPab rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged NPC2 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NPC2 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-NPC2 antibody
This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq]
Product Categories/Family for anti-NPC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,416 Da
NCBI Official Full Name
epididymal secretory protein E1
NCBI Official Synonym Full Names
NPC intracellular cholesterol transporter 2
NCBI Official Symbol
NPC2
NCBI Official Synonym Symbols
HE1; EDDM1
NCBI Protein Information
epididymal secretory protein E1

NCBI Description

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq, Jul 2008]

Research Articles on NPC2

Similar Products

Product Notes

The NPC2 (Catalog #AAA6173710) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NPC2 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NPC2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NPC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.