Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NOVA1 monoclonal antibody (M10), clone 5D9. Western Blot analysis of NOVA1 expression in PC-12 (Cat # L012V1).)

Mouse NOVA1 Monoclonal Antibody | anti-NOVA1 antibody

NOVA1 (neuro-oncological ventral antigen 1, Nova-1) (FITC)

Gene Names
NOVA1; Nova-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NOVA1; Monoclonal Antibody; NOVA1 (neuro-oncological ventral antigen 1; Nova-1) (FITC); neuro-oncological ventral antigen 1; Nova-1; anti-NOVA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5D9
Specificity
Recognizes NOVA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NOVA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NOVA1 (NP_002506, 408aa-507aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NOVA1 monoclonal antibody (M10), clone 5D9. Western Blot analysis of NOVA1 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (NOVA1 monoclonal antibody (M10), clone 5D9. Western Blot analysis of NOVA1 expression in PC-12 (Cat # L012V1).)
Related Product Information for anti-NOVA1 antibody
This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-NOVA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,253 Da
NCBI Official Full Name
RNA-binding protein Nova-1 isoform 1
NCBI Official Synonym Full Names
neuro-oncological ventral antigen 1
NCBI Official Symbol
NOVA1
NCBI Official Synonym Symbols
Nova-1
NCBI Protein Information
RNA-binding protein Nova-1; onconeural ventral antigen 1; paraneoplastic Ri antigen; ventral neuron-specific protein 1
UniProt Protein Name
RNA-binding protein Nova-1
Protein Family
UniProt Gene Name
NOVA1
UniProt Entry Name
NOVA1_HUMAN

Uniprot Description

NOVA1: May regulate RNA splicing or metabolism in a specific subset of developing neurons. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 14q

Cellular Component: intracellular membrane-bound organelle; nucleolus; nucleus

Molecular Function: mRNA binding; RNA binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; synaptic transmission; regulation of RNA metabolic process; RNA splicing; locomotory behavior

Similar Products

Product Notes

The NOVA1 nova1 (Catalog #AAA6177143) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NOVA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOVA1 nova1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOVA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.