Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NOV expression in transfected 293T cell line by NOV monoclonal antibody (M02), clone 2G8.Lane 1: NOV transfected lysate (39.2 KDa).Lane 2: Non-transfected lysate.)

Mouse NOV Monoclonal Antibody | anti-NOV antibody

NOV (Nephroblastoma Overexpressed Gene, CCN3, IGFBP9) (APC)

Gene Names
NOV; CCN3; NOVh; IBP-9; IGFBP9; IGFBP-9
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
NOV; Monoclonal Antibody; NOV (Nephroblastoma Overexpressed Gene; CCN3; IGFBP9) (APC); Nephroblastoma Overexpressed Gene; IGFBP9; anti-NOV antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G8
Specificity
Recognizes NOV.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NOV antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NOV (NP_002505.1, 32aa-131aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQC
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NOV expression in transfected 293T cell line by NOV monoclonal antibody (M02), clone 2G8.Lane 1: NOV transfected lysate (39.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NOV expression in transfected 293T cell line by NOV monoclonal antibody (M02), clone 2G8.Lane 1: NOV transfected lysate (39.2 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NOV transfected lysate using anti-NOV monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NOV MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NOV transfected lysate using anti-NOV monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NOV MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-NOV antibody
The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq]
Product Categories/Family for anti-NOV antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,162 Da
NCBI Official Full Name
protein NOV homolog
NCBI Official Synonym Full Names
nephroblastoma overexpressed
NCBI Official Symbol
NOV
NCBI Official Synonym Symbols
CCN3; NOVh; IBP-9; IGFBP9; IGFBP-9
NCBI Protein Information
protein NOV homolog; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog
UniProt Protein Name
Protein NOV homolog
Protein Family
UniProt Gene Name
NOV
UniProt Synonym Gene Names
CCN3; IGFBP9; NOVH; NovH; IBP-9; IGF-binding protein 9; IGFBP-9
UniProt Entry Name
NOV_HUMAN

NCBI Description

The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq, Feb 2009]

Uniprot Description

NOV: Immediate-early protein likely to play a role in cell growth regulation. Belongs to the CCN family. Expression is down-regulated by WT1. Interacts with FBLN1.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.1

Cellular Component: proteinaceous extracellular matrix; intracellular membrane-bound organelle; cell soma; axon; dendrite

Molecular Function: heparin binding; integrin binding; insulin-like growth factor binding; growth factor activity

Biological Process: cell-cell signaling; regulation of gene expression; regulation of cell growth; cell adhesion; signal transduction

Research Articles on NOV

Similar Products

Product Notes

The NOV nov (Catalog #AAA6169312) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NOV can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOV nov for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOV, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.