Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NOTCH3 Monoclonal Antibody | anti-NOTCH3 antibody

NOTCH3 (Neurogenic Locus Notch Homolog Protein 3, Notch 3, Notch 3 Extracellular Truncation, Notch 3 Intracellular Domain) (MaxLight 490)

Gene Names
NOTCH3; IMF2; CASIL; CADASIL
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NOTCH3; Monoclonal Antibody; NOTCH3 (Neurogenic Locus Notch Homolog Protein 3; Notch 3; Notch 3 Extracellular Truncation; Notch 3 Intracellular Domain) (MaxLight 490); anti-NOTCH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G5
Specificity
Recognizes human NOTCH3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-NOTCH3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa47-157 from human NOTCH3 (NP_000426) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NOTCH3 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-NOTCH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
243,631 Da
NCBI Official Full Name
neurogenic locus notch homolog protein 3
NCBI Official Synonym Full Names
notch 3
NCBI Official Symbol
NOTCH3
NCBI Official Synonym Symbols
IMF2; CASIL; CADASIL
NCBI Protein Information
neurogenic locus notch homolog protein 3; Notch homolog 3
UniProt Protein Name
Neurogenic locus notch homolog protein 3
UniProt Gene Name
NOTCH3
UniProt Synonym Gene Names
Notch 3
UniProt Entry Name
NOTC3_HUMAN

Uniprot Description

NOTCH3: Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Heterodimer of a C-terminal fragment N(TM) and a N- terminal fragment N(EC) which are probably linked by disulfide bonds. Interacts with MAML1, MAML2 and MAML3 which act as transcriptional coactivators for NOTCH3. Interacts with PSMA1. Interacts with HIF1AN. Ubiquitously expressed in fetal and adult tissues. Belongs to the NOTCH family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2-p13.1

Cellular Component: Golgi membrane; nucleoplasm; endoplasmic reticulum membrane; cytoplasm; integral to membrane; plasma membrane; extracellular region; cytosol; receptor complex; actin cytoskeleton

Molecular Function: protein binding; enzyme binding; calcium ion binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; negative regulation of neuron differentiation; regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; forebrain development; neuron fate commitment; Notch receptor processing; gene expression

Disease: Cerebral Arteriopathy, Autosomal Dominant, With Subcortical Infarcts And Leukoencephalopathy; Lateral Meningocele Syndrome; Myofibromatosis, Infantile, 2

Similar Products

Product Notes

The NOTCH3 notch3 (Catalog #AAA6202161) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOTCH3 (Neurogenic Locus Notch Homolog Protein 3, Notch 3, Notch 3 Extracellular Truncation, Notch 3 Intracellular Domain) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOTCH3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOTCH3 notch3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOTCH3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.