Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human NOS2 Monoclonal Antibody | anti-NOS2 antibody

NOS2 (NOS2A, Nitric Oxide Synthase, Inducible, Hepatocyte NOS, Inducible NO Synthase, NOS Type II, Peptidyl-cysteine S-nitrosylase NOS2) (FITC)

Gene Names
NOS2; NOS; INOS; NOS2A; HEP-NOS
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NOS2; Monoclonal Antibody; NOS2 (NOS2A; Nitric Oxide Synthase; Inducible; Hepatocyte NOS; Inducible NO Synthase; NOS Type II; Peptidyl-cysteine S-nitrosylase NOS2) (FITC); anti-NOS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G4
Specificity
Recognizes human NOS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1153
Applicable Applications for anti-NOS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa685-795 from human NOS2 (NP_000616) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged NOS2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NOS2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NOS2 antibody
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.
Product Categories/Family for anti-NOS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nitric oxide synthase, inducible
NCBI Official Synonym Full Names
nitric oxide synthase 2
NCBI Official Symbol
NOS2
NCBI Official Synonym Symbols
NOS; INOS; NOS2A; HEP-NOS
NCBI Protein Information
nitric oxide synthase, inducible
UniProt Protein Name
Nitric oxide synthase, inducible
Protein Family
UniProt Gene Name
NOS2
UniProt Synonym Gene Names
NOS2A; HEP-NOS; Inducible NOS; iNOS
UniProt Entry Name
NOS2_HUMAN

NCBI Description

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

iNOS: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such COX2. Homodimer. Binds SLC9A3R1. By endotoxins and cytokines. Induced by IFNG/IFN-gamma acting synergistically with bacterial lipopolysaccharides (LPS), TNF or IL1B/interleukin-1 beta. Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets. Regulated by calcium/calmodulin. Aspirin inhibits expression and function of this enzyme and effects may be exerted at the level of translational/post-translational modification and directly on the catalytic activity. Belongs to the NOS family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.14.13.39; Amino Acid Metabolism - arginine and proline; Oxidoreductase

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cortical cytoskeleton; perinuclear region of cytoplasm; cytoplasm; peroxisome; intracellular; nucleus; cytosol

Molecular Function: calmodulin binding; protein binding; protein homodimerization activity; FAD binding; NADPH-hemoprotein reductase activity; FMN binding; nitric-oxide synthase activity; iron ion binding; heme binding; NADP binding; receptor binding

Biological Process: circadian rhythm; interaction with host; superoxide metabolic process; positive regulation of guanylate cyclase activity; positive regulation of killing of cells of another organism; defense response to Gram-negative bacterium; positive regulation of vasodilation; regulation of cell proliferation; regulation of cellular respiration; positive regulation of leukocyte mediated cytotoxicity; innate immune response in mucosa; response to bacterium; defense response to bacterium; peptidyl-cysteine S-nitrosylation; response to hypoxia; arginine catabolic process; negative regulation of blood pressure; blood coagulation; negative regulation of protein catabolic process; inflammatory response; nitric oxide biosynthetic process; regulation of insulin secretion; nitric oxide mediated signal transduction

Disease: Hypertension, Essential; Malaria, Susceptibility To

Research Articles on NOS2

Similar Products

Product Notes

The NOS2 nos2 (Catalog #AAA6148527) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOS2 (NOS2A, Nitric Oxide Synthase, Inducible, Hepatocyte NOS, Inducible NO Synthase, NOS Type II, Peptidyl-cysteine S-nitrosylase NOS2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOS2 nos2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.