Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NOLC1 monoclonal antibody (M01), clone 3F8. Western Blot analysis of NOLC1 expression in HepG2.)

Mouse NOLC1 Monoclonal Antibody | anti-NOLC1 antibody

NOLC1 (Nucleolar and Coiled-body Phosphoprotein 1, KIAA0035, NOPP130, NOPP140, NS5ATP13, P130) (APC)

Gene Names
NOLC1; P130; NOPP130; NOPP140; NS5ATP13
Applications
Western Blot
Purity
Purified
Synonyms
NOLC1; Monoclonal Antibody; NOLC1 (Nucleolar and Coiled-body Phosphoprotein 1; KIAA0035; NOPP130; NOPP140; NS5ATP13; P130) (APC); Nucleolar and Coiled-body Phosphoprotein 1; P130; anti-NOLC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
3F8
Specificity
Recognizes NOLC1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NOLC1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NOLC1 (NP_004732, 590aa-699aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(NOLC1 monoclonal antibody (M01), clone 3F8. Western Blot analysis of NOLC1 expression in HepG2.)

Western Blot (WB) (NOLC1 monoclonal antibody (M01), clone 3F8. Western Blot analysis of NOLC1 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged NOLC1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NOLC1 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of NOLC1 expression in transfected 293T cell line by NOLC1 monoclonal antibody (M01), clone 3F8.Lane 1: NOLC1 transfected lysate (Predicted MW: 73.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NOLC1 expression in transfected 293T cell line by NOLC1 monoclonal antibody (M01), clone 3F8.Lane 1: NOLC1 transfected lysate (Predicted MW: 73.7 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-NOLC1 antibody
Mouse monoclonal antibody raised against a partial recombinant NOLC1.
Product Categories/Family for anti-NOLC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
nucleolar and coiled-body phosphoprotein 1 isoform 2
NCBI Official Synonym Full Names
nucleolar and coiled-body phosphoprotein 1
NCBI Official Symbol
NOLC1
NCBI Official Synonym Symbols
P130; NOPP130; NOPP140; NS5ATP13
NCBI Protein Information
nucleolar and coiled-body phosphoprotein 1
UniProt Protein Name
Nucleolar and coiled-body phosphoprotein 1
UniProt Gene Name
NOLC1
UniProt Synonym Gene Names
KIAA0035; NS5ATP13; Nopp140
UniProt Entry Name
NOLC1_HUMAN

Uniprot Description

NOLC1: Related to nucleologenesis, may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. May play an important role in transcription catalyzed by RNA polymerase I. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Nucleolus; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 10q24.32

Cellular Component: nucleoplasm; Cajal body; cytoplasm; nucleolus

Molecular Function: protein binding; GTP binding; ATP binding

Biological Process: mitosis; cell cycle; rRNA processing; nucleolus organization and biogenesis

Research Articles on NOLC1

Similar Products

Product Notes

The NOLC1 nolc1 (Catalog #AAA6168605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NOLC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOLC1 nolc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOLC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.