Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NOC3L Monoclonal Antibody | anti-NOC3L antibody

NOC3L (Nucleolar Complex Protein 3 Homolog, NOC3 Protein Homolog, Factor for Adipocyte Differentiation 24, NOC3-like Protein, Nucleolar Complex-associated Protein 3-like Protein, AD24, C10orf117, FAD24, FLJ12820) (MaxLight 490)

Gene Names
NOC3L; AD24; FAD24; C10orf117
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NOC3L; Monoclonal Antibody; NOC3L (Nucleolar Complex Protein 3 Homolog; NOC3 Protein Homolog; Factor for Adipocyte Differentiation 24; NOC3-like Protein; Nucleolar Complex-associated Protein 3-like Protein; AD24; C10orf117; FAD24; FLJ12820) (MaxLight 490); anti-NOC3L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5E8
Specificity
Recognizes human NOC3L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-NOC3L antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa702-801 from human NOC3L (NP_071896) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NOC3L antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-NOC3L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
nucleolar complex protein 3 homolog
NCBI Official Synonym Full Names
NOC3 like DNA replication regulator
NCBI Official Symbol
NOC3L
NCBI Official Synonym Symbols
AD24; FAD24; C10orf117
NCBI Protein Information
nucleolar complex protein 3 homolog
UniProt Protein Name
Nucleolar complex protein 3 homolog
Protein Family
UniProt Gene Name
NOC3L
UniProt Synonym Gene Names
AD24; C10orf117; FAD24; NOC3 protein homolog
UniProt Entry Name
NOC3L_HUMAN

Uniprot Description

NOC3L: May be required for adipogenesis. Belongs to the CBF/MAK21 family.

Protein type: RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: nucleolus; nuclear speck

Biological Process: fat cell differentiation

Research Articles on NOC3L

Similar Products

Product Notes

The NOC3L noc3l (Catalog #AAA6202147) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOC3L (Nucleolar Complex Protein 3 Homolog, NOC3 Protein Homolog, Factor for Adipocyte Differentiation 24, NOC3-like Protein, Nucleolar Complex-associated Protein 3-like Protein, AD24, C10orf117, FAD24, FLJ12820) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOC3L can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOC3L noc3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOC3L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.