Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NMNAT2 monoclonal antibody (M02), clone 4E6. Western Blot analysis of NMNAT2 expression in MCF-7.)

Mouse NMNAT2 Monoclonal Antibody | anti-NMNAT2 antibody

NMNAT2 (Nicotinamide Nucleotide adenylyltransferase 2, C1orf15, KIAA0479, MGC2756, PNAT-2, PNAT2) (FITC)

Gene Names
NMNAT2; PNAT2; C1orf15
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NMNAT2; Monoclonal Antibody; NMNAT2 (Nicotinamide Nucleotide adenylyltransferase 2; C1orf15; KIAA0479; MGC2756; PNAT-2; PNAT2) (FITC); Nicotinamide Nucleotide adenylyltransferase 2; PNAT2; anti-NMNAT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4000000
Specificity
Recognizes NMNAT2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NMNAT2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NMNAT2 (NP_055854, 208aa-307aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NMNAT2 monoclonal antibody (M02), clone 4E6. Western Blot analysis of NMNAT2 expression in MCF-7.)

Western Blot (WB) (NMNAT2 monoclonal antibody (M02), clone 4E6. Western Blot analysis of NMNAT2 expression in MCF-7.)
Related Product Information for anti-NMNAT2 antibody
This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-NMNAT2 antibody
References
1. Nmnat2 delays axon degeneration in superior cervical ganglia dependent on its NAD synthesis activity. Yan T, Feng Y, Zheng J, Ge X, Zhang Y, Wu D, Zhao J, Zhai Q.Neurochem Int. 2009 Sep 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.6 kDa (327aa)
NCBI Official Full Name
nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 isoform 1
NCBI Official Synonym Full Names
nicotinamide nucleotide adenylyltransferase 2
NCBI Official Symbol
NMNAT2
NCBI Official Synonym Symbols
PNAT2; C1orf15
NCBI Protein Information
nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
UniProt Protein Name
Nicotinamide mononucleotide adenylyltransferase 2
UniProt Gene Name
NMNAT2
UniProt Synonym Gene Names
C1orf15; KIAA0479; NMN adenylyltransferase 2; NaMN adenylyltransferase 2
UniProt Entry Name
NMNA2_HUMAN

NCBI Description

This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NMNAT2: Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate but with a lower efficiency. Cannot use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity prefers NAD(+), NADH and NAAD as substrates and degrades nicotinic acid adenine dinucleotide phosphate (NHD) less effectively. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Belongs to the eukaryotic NMN adenylyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.7.7.18; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 2.7.7.1

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: Golgi membrane; Golgi apparatus; late endosome; synapse; trans-Golgi network

Molecular Function: nicotinamide-nucleotide adenylyltransferase activity; nicotinate-nucleotide adenylyltransferase activity; ATP binding

Biological Process: NAD biosynthetic process; vitamin metabolic process; NAD metabolic process; water-soluble vitamin metabolic process

Research Articles on NMNAT2

Similar Products

Product Notes

The NMNAT2 nmnat2 (Catalog #AAA6177241) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NMNAT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NMNAT2 nmnat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NMNAT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.