Mouse NME2 Monoclonal Antibody | anti-NME2 antibody

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (PE)

Cat. Num. AAA6185540

• Gene Names: NME2; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
• Applications: Western Blot
• Purity: Purified
• Synonyms: NME2; Monoclonal Antibody; NME2 (Non-Metastatic Cells 2; Protein (NM23B) Expressed in; MGC111212; NDPK-B; NDPKB; NM23-H2; NM23B; puf) (PE); Non-Metastatic Cells 2; puf; anti-NME2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 1D4
• Specificity: Recognizes NME2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 152

• Applicable Applications for anti-NME2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NME2 (NP_002503, 51aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(NME2 monoclonal antibody (M05), clone 1D4 Western Blot analysis of NME2 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged NME2 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(NME2 monoclonal antibody (M05), clone 1D4. Western Blot analysis of NME2 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(NME2 monoclonal antibody (M05), clone 1D4. Western Blot analysis of NME2 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(NME2 monoclonal antibody (M05), clone 1D4. Western Blot analysis of NME2 expression in Raw 264.7 (Cat # L024V1).)

Related Product Information for anti-NME2 antibody

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Product Categories/Family for anti-NME2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505409
• NCBI GeneID: 4831
• NCBI Accession #: NP_002503
• NCBI GenBank Nucleotide #: NP_002503.1
• UniProt Accession #: P22392
• NCBI Official Full Name: nucleoside diphosphate kinase B isoform a
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 2
• NCBI Official Symbol: NME2
• NCBI Official Synonym Symbols: PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
• NCBI Protein Information: nucleoside diphosphate kinase B
• UniProt Protein Name: Nucleoside diphosphate kinase B
• UniProt Gene Name: NME2
• UniProt Synonym Gene Names: NM23B; NDK B; NDP kinase B
• UniProt Entry Name: NDKB_HUMAN

NCBI Description

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Nov 2010]

Uniprot Description

NME2: Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed:8392752). Exhibits histidine protein kinase activity. Belongs to the NDK family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, other; Nucleotide Metabolism - pyrimidine; EC 2.7.13.3; Nucleotide Metabolism - purine; Nuclear receptor co-regulator; EC 2.7.4.6; Kinase, nucleoside diphosphate; Other group; NDK family

Chromosomal Location of Human Ortholog: 17q21.3

Cellular Component: ruffle; centrosome; focal adhesion; membrane; mitochondrion; perinuclear region of cytoplasm; lamellipodium; cytoplasm; intermediate filament; cytosol; nucleus

Molecular Function: gamma-tubulin binding; protein binding; protein histidine kinase activity; metal ion binding; nucleoside diphosphate kinase activity; intermediate filament binding; protein kinase binding; transcription factor activity; ATP binding; single-stranded DNA binding

Biological Process: integrin-mediated signaling pathway; GTP biosynthetic process; peptidyl-histidine phosphorylation; response to cAMP; transcription, DNA-dependent; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; negative regulation of myeloid leukocyte differentiation; UTP biosynthetic process; hippocampus development; nucleoside diphosphate phosphorylation; response to testosterone stimulus; CTP biosynthetic process; regulation of transcription, DNA-dependent; pyrimidine nucleotide metabolic process; nucleoside triphosphate biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; cell adhesion; positive regulation of epithelial cell proliferation; regulation of epidermis development; response to amine stimulus; positive regulation of keratinocyte differentiation; purine nucleotide metabolic process; negative regulation of apoptosis