Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NKX2-1 Monoclonal Antibody | anti-NKX2-1 antibody

NKX2-1 (NKX2A, TITF1, TTF1, Homeobox Protein Nkx-2.1, Homeobox Protein NK-2 Homolog A, Thyroid Nuclear Factor 1, Thyroid Transcription Factor 1) (MaxLight 405)

Gene Names
NKX2-1; BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NKX2-1; Monoclonal Antibody; NKX2-1 (NKX2A; TITF1; TTF1; Homeobox Protein Nkx-2.1; Homeobox Protein NK-2 Homolog A; Thyroid Nuclear Factor 1; Thyroid Transcription Factor 1) (MaxLight 405); anti-NKX2-1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b, lambda
Clone Number
2B9
Specificity
Recognizes human TITF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
371
Applicable Applications for anti-NKX2-1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa77-158 from human TITF1 (NP_003308) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NKX2-1 antibody
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NKX2-1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
homeobox protein Nkx-2.1 isoform 2
NCBI Official Synonym Full Names
NK2 homeobox 1
NCBI Official Symbol
NKX2-1
NCBI Official Synonym Symbols
BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1
NCBI Protein Information
homeobox protein Nkx-2.1
UniProt Protein Name
Homeobox protein Nkx-2.1
Protein Family
UniProt Gene Name
NKX2-1
UniProt Synonym Gene Names
NKX2A; TITF1; TTF1; TTF-1; T/EBP
UniProt Entry Name
NKX21_HUMAN

NCBI Description

This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription. [provided by RefSeq, Feb 2014]

Uniprot Description

NKX2-1: Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Defects in NKX2-1 are the cause of benign hereditary chorea (BHC); also known as hereditary chorea without dementia. BHC is an autosomal dominant movement disorder. The early onset of symptoms (usully before the age of 5) and the observation that in some BHC families the symptoms tend to decrease in adulthood suggests that the disorder results from a developmental disturbance of the brain. BHC is non-progressive and patients have normal or slightly below normal intelligence. There is considerable inter- and intrafamilial variability, including dysarthria, axial distonia and gait disturbances. Defects in NKX2-1 are the cause of choreoathetosis, hypothyroidism, and neonatal respiratory distress (CHNRD). This syndrome include neurological, thyroid, and respiratory problems. Belongs to the NK-2 homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 14q13

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; enzyme binding; DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; axon guidance; positive regulation of transcription, DNA-dependent; rhythmic process; neuron migration; response to hormone stimulus; globus pallidus development; locomotory behavior; forebrain dorsal/ventral pattern formation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of circadian rhythm; Leydig cell differentiation; phospholipid metabolic process; forebrain development; thyroid gland development; oligodendrocyte differentiation; anatomical structure formation; forebrain neuron fate commitment; negative regulation of cell migration; hippocampus development; induction; cerebral cortex GABAergic interneuron differentiation; cerebral cortex cell migration; pituitary gland development; positive regulation of transcription from RNA polymerase II promoter; brain development; negative regulation of transcription, DNA-dependent; negative regulation of transforming growth factor beta receptor signaling pathway; endoderm development; lung development

Disease: Thyroid Carcinoma, Papillary; Chorea, Benign Hereditary; Choreoathetosis And Congenital Hypothyroidism With Or Without Pulmonary Dysfunction

Research Articles on NKX2-1

Similar Products

Product Notes

The NKX2-1 nkx2-1 (Catalog #AAA6191452) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NKX2-1 (NKX2A, TITF1, TTF1, Homeobox Protein Nkx-2.1, Homeobox Protein NK-2 Homolog A, Thyroid Nuclear Factor 1, Thyroid Transcription Factor 1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NKX2-1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NKX2-1 nkx2-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NKX2-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.