Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (41.73kD).)

Mouse anti-Human NIFUN Monoclonal Antibody | anti-NIFUN antibody

NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, NifU-like N-Terminal Domain-Containing Protein, NifU-like Protein, ISCU) (FITC)

Gene Names
ISCU; HML; ISU2; NIFU; NIFUN; hnifU; 2310020H20Rik
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NIFUN; Monoclonal Antibody; NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU; Mitochondrial; NifU-like N-Terminal Domain-Containing Protein; NifU-like Protein; ISCU) (FITC); anti-NIFUN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B8-1C4
Specificity
Recognizes human NIFUN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NIFUN antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa26-167 from NIFUN (AAH11906) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (41.73kD).)

Western Blot (WB)

(NIFUN monoclonal antibody Western Blot analysis of NIFUN expression in HL-60.)

Western Blot (WB) (NIFUN monoclonal antibody Western Blot analysis of NIFUN expression in HL-60.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NIFUN on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NIFUN on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NIFUN is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NIFUN is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-NIFUN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
17,999 Da
NCBI Official Full Name
Homo sapiens iron-sulfur cluster scaffold homolog (E. coli), mRNA
NCBI Official Synonym Full Names
iron-sulfur cluster scaffold homolog (E. coli)
NCBI Official Symbol
ISCU
NCBI Official Synonym Symbols
HML; ISU2; NIFU; NIFUN; hnifU; 2310020H20Rik
NCBI Protein Information
iron-sulfur cluster assembly enzyme ISCU, mitochondrial; nifU-like protein; NifU-like N-terminal domain containing; IscU iron-sulfur cluster scaffold homolog; nifU-like N-terminal domain-containing protein
UniProt Protein Name
Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
UniProt Gene Name
ISCU
UniProt Synonym Gene Names
NIFUN
UniProt Entry Name
ISCU_HUMAN

NCBI Description

Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq, Jul 2008]

Uniprot Description

ISCU: Involved in the assembly or repair of the [Fe-S] clusters present in iron-sulfur proteins. Binds iron. Defects in ISCU are the cause of myopathy with exercise intolerance Swedish type (MEIS); also known as myopathy with deficiency of succinate dehydrogenase and aconitase or myoglobinuria due to abnormal glycolysis or hereditary myopathy with lactic acidosis (HML). This autosomal recessive metabolic disease is characterized by lifelong severe exercise intolerance, in which minor exertion causes fatigue of active muscles, shortness of breath, and cardiac palpitations in association with lactic acidosis. The biochemical phenotype is characterized by a deficiency in mitochondrial iron-sulfur proteins and impaired muscle oxidative metabolism. Belongs to the NifU family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 12q24.1

Cellular Component: mitochondrion; mitochondrial matrix; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; iron ion binding; iron-sulfur cluster binding; protein complex scaffold

Biological Process: iron-sulfur cluster assembly; nitrogen fixation

Disease: Myopathy With Lactic Acidosis, Hereditary

Research Articles on NIFUN

Similar Products

Product Notes

The NIFUN iscu (Catalog #AAA6148487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, NifU-like N-Terminal Domain-Containing Protein, NifU-like Protein, ISCU) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NIFUN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NIFUN iscu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NIFUN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.