Mouse anti-Human NFRKB Monoclonal Antibody | anti-NFRKB antibody

NFRKB (Nuclear Factor Related to kappa-B-binding Protein, DNA-binding Protein R kappa-B, INO80 Complex Subunit G, INO80G, DKFZp547B2013)

Cat. Num. AAA6005744

• Gene Names: NFRKB; INO80G
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NFRKB; Monoclonal Antibody; NFRKB (Nuclear Factor Related to kappa-B-binding Protein; DNA-binding Protein R kappa-B; INO80 Complex Subunit G; INO80G; DKFZp547B2013); Anti -NFRKB (Nuclear Factor Related to kappa-B-binding Protein; anti-NFRKB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G8
• Specificity: Recognizes human NFRKB.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: FPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEVVKYRQLCFKSQYKRYLNSQQQYFHRLLKQILASRSDLLEMARRSGPALPFRQKRPSPSRTPEER

• Applicable Applications for anti-NFRKB antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa90-198 from human NFRKB (NP_006156) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-NFRKB antibody

Binds to the DNA consensus sequence 5'-GGGGAATCTCC-3'. Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Modulates the deubiquitinase activity of UCHL5 in the INO80 complex.

Product Categories/Family for anti-NFRKB antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 219802034
• NCBI GeneID: 4798
• NCBI Accession #: NP_001137307.1
• NCBI GenBank Nucleotide #: NM_001143835.1
• UniProt Accession #: Q6P4R8; Q12869; Q15312; Q9H048
• Molecular Weight: 139,001 Da
• NCBI Official Full Name: nuclear factor related to kappa-B-binding protein isoform 1
• NCBI Official Synonym Full Names: nuclear factor related to kappaB binding protein
• NCBI Official Symbol: NFRKB
• NCBI Official Synonym Symbols: INO80G
• NCBI Protein Information: nuclear factor related to kappa-B-binding protein; INO80 complex subunit G; DNA-binding protein R kappa B; DNA-binding protein R kappa-B
• UniProt Protein Name: Nuclear factor related to kappa-B-binding protein
• Protein Family: Nuclear factor related to kappa-B-binding protein
• UniProt Gene Name: NFRKB
• UniProt Synonym Gene Names: INO80G
• UniProt Entry Name: NFRKB_HUMAN

Uniprot Description

Function: Binds to the DNA consensus sequence 5'-GGGGAATCTCC-3'. Ref.7Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Modulates the deubiquitinase activity of UCHL5 in the INO80 complex. Ref.7

Subunit structure: Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the N-terminus of INO80. Interacts with UCHL5; NFRKB competes with ADRM1 for interaction with UCHL5. Ref.5 Ref.7 Ref.13

Subcellular location: Nucleus Ref.7.

Tissue specificity: Expressed in thymus, brain, testes, spleen and liver. Ref.1

Domain: NFRKB seems to be mostly disordered. The wing-helix like domain doesn't bind DNA.

Sequence similarities: Belongs to the NFRKB family.

Sequence caution: The sequence AAA17871.1 differs from that shown. Reason: Frameshift at position 1267.