Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NEUROG2 monoclonal antibody (M10), clone 2A8. Western Blot analysis of NEUROG2 expression in H9c2 (2-1).)

Mouse NEUROG2 Monoclonal Antibody | anti-NEUROG2 antibody

NEUROG2 (Neurogenin 2, Atoh4, MGC46562, Math4A, NGN2, bHLHa8, ngn-2) (APC)

Gene Names
NEUROG2; NGN2; Atoh4; ngn-2; Math4A; bHLHa8
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NEUROG2; Monoclonal Antibody; NEUROG2 (Neurogenin 2; Atoh4; MGC46562; Math4A; NGN2; bHLHa8; ngn-2) (APC); Neurogenin 2; ngn-2; anti-NEUROG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A8
Specificity
Recognizes NEUROG2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NEUROG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NEUROG2 (NP_076924, 74aa-175aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(NEUROG2 monoclonal antibody (M10), clone 2A8. Western Blot analysis of NEUROG2 expression in H9c2 (2-1).)

Western Blot (WB) (NEUROG2 monoclonal antibody (M10), clone 2A8. Western Blot analysis of NEUROG2 expression in H9c2 (2-1).)
Related Product Information for anti-NEUROG2 antibody
Neurogenin-2 is a member of the neurogenin subfamily of basic helix-loop-helix (bHLH) transcription factor genes that play an important role in neurogenesis from migratory neural crest cells. [supplied by OMIM]
Product Categories/Family for anti-NEUROG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
neurogenin-2
NCBI Official Synonym Full Names
neurogenin 2
NCBI Official Symbol
NEUROG2
NCBI Official Synonym Symbols
NGN2; Atoh4; ngn-2; Math4A; bHLHa8
NCBI Protein Information
neurogenin-2; protein atonal homolog 4; class A basic helix-loop-helix protein 8
UniProt Protein Name
Neurogenin-2
Protein Family
UniProt Gene Name
NEUROG2
UniProt Synonym Gene Names
ATOH4; BHLHA8; NGN2; NGN-2; bHLHa8
UniProt Entry Name
NGN2_HUMAN

NCBI Description

This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The protein product of this gene also plays a role in the differentiation and survival of midbrain dopaminergic neurons. [provided by RefSeq, Apr 2012]

Uniprot Description

neurogenin 2: Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3').

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: nucleus

Molecular Function: protein dimerization activity; sequence-specific DNA binding

Biological Process: axon guidance; cell fate commitment; transcription, DNA-dependent; forebrain development; cell maturation; neuron migration; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of neuron differentiation; central nervous system neuron development

Research Articles on NEUROG2

Similar Products

Product Notes

The NEUROG2 neurog2 (Catalog #AAA6167076) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NEUROG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEUROG2 neurog2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEUROG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.