<
Western Blot (WB)
(NEK2 monoclonal antibody (M02), clone 2F9 Western Blot analysis of NEK2 expression in PC-12 (Cat # L012V1).)
Mouse NEK2 Monoclonal Antibody | anti-NEK2 antibody
NEK2 (NIMA (never in Mitosis Gene a)-Related Kinase 2, HsPK21, NEK2A, NLK1) (PE)
Gene Names
NEK2; NLK1; RP67; NEK2A; HsPK21; PPP1R111
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
NEK2; Monoclonal Antibody; NEK2 (NIMA (never in Mitosis Gene a)-Related Kinase 2; HsPK21; NEK2A; NLK1) (PE); NIMA (never in Mitosis Gene a)-Related Kinase 2; NLK1; anti-NEK2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F9
Specificity
Recognizes NEK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
445
Applicable Applications for anti-NEK2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NEK2 (AAH43502, 331aa-445aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(NEK2 monoclonal antibody (M02), clone 2F9 Western Blot analysis of NEK2 expression in PC-12 (Cat # L012V1).)
Western Blot (WB)
(NEK2 monoclonal antibody (M02), clone 2F9 Western Blot analysis of NEK2 expression in PC-12 (Cat # L012V1).)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 30 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 30 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 30 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 30 ug/ml])
Testing Data
(Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-NEK2 antibody
Mouse monoclonal antibody raised against a partial recombinant NEK2.
Product Categories/Family for anti-NEK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
NIMA (never in mitosis gene a)-related kinase 2
NCBI Official Synonym Full Names
NIMA related kinase 2
NCBI Official Symbol
NEK2
NCBI Official Synonym Symbols
NLK1; RP67; NEK2A; HsPK21; PPP1R111
NCBI Protein Information
serine/threonine-protein kinase Nek2
Protein Family
NCBI Description
This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene. [provided by RefSeq, Feb 2011]
Research Articles on NEK2
Similar Products
Product Notes
The NEK2 (Catalog #AAA6183720) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NEK2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
