Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NEDD9 Monoclonal Antibody | anti-NEDD9 antibody

NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12,

Gene Names
NEDD9; CAS2; CASL; HEF1; CAS-L; CASS2
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
NEDD9; Monoclonal Antibody; NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9; Enhancer of Filamentation 1; hEF1; CRK-associated Substrate-related Protein; CAS-L; CasL; Cas Scaffolding Protein Family Member 2; NEDD-9; Renal Carcinoma Antigen NY-REN-12; ; anti-NEDD9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B4
Specificity
Recognizes human NEDD9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-NEDD9 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa101-200 from human NEDD9 (NP_006394) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NEDD9 antibody
NEDD9 (also HEF1 and CASL) is a 93kD (predicted) member of the CAS family of proteins. It is widely expressed, and serves to integrate integrin b1 and BCR signaling with cell mitotic pathways. Human NEDD9 is 834aa in length. It contains one SH3 domain (aa3-65), a Tyr-rich SH2-binding region (aa90-350), one Ser-rich four a-helix bundle protein interaction site (aa350-650), and an HLH motif that mediates Cas protein dimerization (aa710-760). NEDD9 usually runs at 105-115kD in SDS-PAGE due to phosphorylation. It is also cleaved near Leu361 to generate an active N-terminal 55kD fragment. One isoform shows a deletion of aa155-188, while two others show 20-7aa substitutions for aa155-834, 1-153, respectively. Over aa153-366, human and mouse NEDD9 share 85aa identity.
Product Categories/Family for anti-NEDD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
enhancer of filamentation 1 isoform 1
NCBI Official Synonym Full Names
neural precursor cell expressed, developmentally down-regulated 9
NCBI Official Symbol
NEDD9
NCBI Official Synonym Symbols
CAS2; CASL; HEF1; CAS-L; CASS2
NCBI Protein Information
enhancer of filamentation 1
UniProt Protein Name
Enhancer of filamentation 1
Protein Family
UniProt Gene Name
NEDD9
UniProt Synonym Gene Names
CASL; CASS2; hEF1; CAS-L; CasL; NEDD-9
UniProt Entry Name
CASL_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

Cas-L: a widely expressed docking protein which plays a central coordinating role for tyrosine-kinase-based signaling in cell adhesion. May function in transmitting growth control signals between focal adhesions at the cell periphery and the mitotic spindle in response to adhesion or growth factor signals initiating cell proliferation. Integrin beta-1 stimulation leads to recruitment of various proteins including CRK, NCK and SHPTP2 to the tyrosine phosphorylated form. Phosphorylated following integrin beta-1, antigen receptor, or C1a calcitonin receptor signaling. Transformation of fibroblasts with v-ABL results in an increase in its tyrosine phosphorylation. Phosphorylated by focal adhesion kinase. Highly expressed in kidney, lung, and placenta. Also detected in T-cells, B-cells and diverse cell lines.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 6p24.2

Cellular Component: spindle pole; Golgi apparatus; focal adhesion; lamellipodium; cytoplasm; spindle; cell cortex; nucleus

Molecular Function: protein binding

Biological Process: integrin-mediated signaling pathway; mitosis; actin filament bundle formation; cell division; regulation of growth; cytoskeleton organization and biogenesis; signal transduction; cell adhesion

Research Articles on NEDD9

Similar Products

Product Notes

The NEDD9 nedd9 (Catalog #AAA6191395) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEDD9 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEDD9 nedd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEDD9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.