Mouse anti-Human NDUFB3 Monoclonal Antibody | anti-NDUFB3 antibody

NDUFB3 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 3, NADH-Ubiquinone Oxidoreductase B12 Subunit, Complex I-B12, CI-B12) (AP)

Cat. Num. AAA6132520

• Gene Names: NDUFB3; B12; CI-B12; MC1DN25
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFB3; Monoclonal Antibody; NDUFB3 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 3; NADH-Ubiquinone Oxidoreductase B12 Subunit; Complex I-B12; CI-B12) (AP); anti-NDUFB3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6C6
• Specificity: Recognizes human NDUFB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 98

• Applicable Applications for anti-NDUFB3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa13-65 from human NDUFB3 (NP_002482) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSD
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.57kD).)

Western Blot (WB)

(NDUFB3 monoclonal antibody Western Blot analysis of NDUFB3 expression in HeLa.)

Western Blot (WB)

(NDUFB3 monoclonal antibody Western Blot analysis of NDUFB3 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged NDUFB3 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-NDUFB3 antibody

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Product Categories/Family for anti-NDUFB3 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 4505361
• NCBI GeneID: 4709
• NCBI Accession #: NP_002482
• NCBI GenBank Nucleotide #: NM_002491
• UniProt Accession #: O43676
• NCBI Official Full Name: NADH dehydrogenase
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase subunit B3
• NCBI Official Symbol: NDUFB3
• NCBI Official Synonym Symbols: B12; CI-B12; MC1DN25
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
• Protein Family: NADH dehydrogenase
• UniProt Gene Name: NDUFB3
• UniProt Synonym Gene Names: CI-B12
• UniProt Entry Name: NDUB3_HUMAN

NCBI Description

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which is the first enzyme in the electron transport chain of mitochondria. This protein localizes to the inner membrane of the mitochondrion as a single-pass membrane protein. Mutations in this gene contribute to mitochondrial complex 1 deficiency. Alternative splicing results in multiple transcript variants encoding the same protein. Humans have multiple pseudogenes of this gene. [provided by RefSeq, Mar 2012]