Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (42.94kD).)

Mouse anti-Human NDUFB11 Monoclonal Antibody | anti-NDUFB11 antibody

NDUFB11 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 11, Mitochondrial, NADH-Ubiquinone Oxidoreductase ESSS Subunit, Complex I-ESSS, CI-ESSS, Neuronal Protein 17.3, Np17.3, p17.3, UNQ111/PRO1064) (AP)

Gene Names
NDUFB11; ESSS; Np15; P17.3; NP17.3; CI-ESSS; LSDMCA3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFB11; Monoclonal Antibody; NDUFB11 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 11; Mitochondrial; NADH-Ubiquinone Oxidoreductase ESSS Subunit; Complex I-ESSS; CI-ESSS; Neuronal Protein 17.3; Np17.3; p17.3; UNQ111/PRO1064) (AP); anti-NDUFB11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B2
Specificity
Recognizes human NDUFB11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NDUFB11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-154 from NDUFB11 (AAH10665) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.94kD).)

Western Blot (WB) (Western Blot detection against Immunogen (42.94kD).)

Western Blot (WB)

(NDUFB11 monoclonal antibody, Western Blot analysis of NDUFB11 expression in HepG2.)

Western Blot (WB) (NDUFB11 monoclonal antibody, Western Blot analysis of NDUFB11 expression in HepG2.)

Western Blot (WB)

(NDUFB11 monoclonal antibody. Western Blot analysis of NDUFB11 expression in A-431.)

Western Blot (WB) (NDUFB11 monoclonal antibody. Western Blot analysis of NDUFB11 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged NDUFB11 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDUFB11 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NDUFB11 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFB11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
18,364 Da
NCBI Official Full Name
Homo sapiens NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa, mRNA
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit B11
NCBI Official Symbol
NDUFB11
NCBI Official Synonym Symbols
ESSS; Np15; P17.3; NP17.3; CI-ESSS; LSDMCA3
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Protein Family

NCBI Description

NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM, Feb 2009]

Research Articles on NDUFB11

Similar Products

Product Notes

The NDUFB11 (Catalog #AAA6132519) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFB11 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 11, Mitochondrial, NADH-Ubiquinone Oxidoreductase ESSS Subunit, Complex I-ESSS, CI-ESSS, Neuronal Protein 17.3, Np17.3, p17.3, UNQ111/PRO1064) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFB11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFB11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.