Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.99kD).)

Mouse NDUFA9 Monoclonal Antibody | anti-NDUFA9 antibody

NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (AP)

Gene Names
NDUFA9; CC6; CI39k; CI-39k; MC1DN26; NDUFS2L; SDR22E1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFA9; Monoclonal Antibody; NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9; Mitochondrial; NADH-Ubiquinone Oxidoreductase 39kD Subunit; Complex I-39kD; CI-39kD; NDUFS2L; MGC111043) (AP); anti-NDUFA9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D7
Specificity
Recognizes human NDUFA9. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NDUFA9 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa303-377 from human NDUFA9 (NP_004993) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.99kD).)

Western Blot (WB)

(NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in PC-12.)

Western Blot (WB) (NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in PC-12.)

Western Blot (WB)

(NDUFA9 monoclonal antibody. Western Blot analysis of NDUFA9 expression in Raw 264.7.)

Western Blot (WB) (NDUFA9 monoclonal antibody. Western Blot analysis of NDUFA9 expression in Raw 264.7.)

Western Blot (WB)

(NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in NIH/3T3.)

Western Blot (WB) (NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NDUFA9 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NDUFA9 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NDUFA9 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDUFA9 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-NDUFA9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A9
NCBI Official Symbol
NDUFA9
NCBI Official Synonym Symbols
CC6; CI39k; CI-39k; MC1DN26; NDUFS2L; SDR22E1
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
UniProt Gene Name
NDUFA9
UniProt Synonym Gene Names
NDUFS2L; CI-39kD
UniProt Entry Name
NDUA9_HUMAN

NCBI Description

The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. [provided by RefSeq, May 2010]

Uniprot Description

NUEM: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFA9 subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; Mitochondrial; EC 1.6.99.3; Oxidoreductase

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: mitochondrial matrix; mitochondrial inner membrane; mitochondrial membrane; nucleus; mitochondrial respiratory chain complex I

Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity; protein complex binding; coenzyme binding; NADH dehydrogenase activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone; sodium ion transport

Disease: Leigh Syndrome

Research Articles on NDUFA9

Similar Products

Product Notes

The NDUFA9 ndufa9 (Catalog #AAA6132517) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFA9 ndufa9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFA9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.