Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Mouse anti-Human NDRG2 Monoclonal Antibody | anti-NDRG2 antibody

NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522) (PE)

Gene Names
NDRG2; SYLD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDRG2; Monoclonal Antibody; NDRG2 (Protein NDRG2; N-myc Downstream-regulated Gene 2 Protein; Protein Syld709613; KIAA1248; SYLD; DKFZp781G1938; FLJ25522) (PE); anti-NDRG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A5
Specificity
Recognizes human NDRG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NDRG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-97 from human NDRG2 (NP_057334) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB)

(NDRG2 monoclonal antibody, Western Blot analysis of NDRG2 expression in HeLa.)

Western Blot (WB) (NDRG2 monoclonal antibody, Western Blot analysis of NDRG2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of NDRG2 expression in transfected 293T cell line by NDRG2 monoclonal antibody. Lane 1: NDRG2 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDRG2 expression in transfected 293T cell line by NDRG2 monoclonal antibody. Lane 1: NDRG2 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NDRG2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDRG2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-NDRG2 antibody
NDRG2 (NDRG family member 2) belongs to the N-myc downregulated gene family. It is a cytoplasmic protein which may be involved in dendritic cell and neuron differentiation. It is upregulated at both the RNA and protein levels in Alzheimer's disease. NDRG2 mRNA is downregulated or undetectable in several human cancers and cancer cell-lines, suggesting that it may have anti-tumor activity.
Product Categories/Family for anti-NDRG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
protein NDRG2 isoform b
NCBI Official Synonym Full Names
NDRG family member 2
NCBI Official Symbol
NDRG2
NCBI Official Synonym Symbols
SYLD
NCBI Protein Information
protein NDRG2
UniProt Protein Name
Protein NDRG2
Protein Family
UniProt Gene Name
NDRG2
UniProt Synonym Gene Names
KIAA1248; SYLD
UniProt Entry Name
NDRG2_HUMAN

NCBI Description

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017]

Research Articles on NDRG2

Similar Products

Product Notes

The NDRG2 ndrg2 (Catalog #AAA6159025) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDRG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDRG2 ndrg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDRG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.