Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Mouse NCOA4 Monoclonal Antibody | anti-NCOA4 antibody

NCOA4 (Nuclear Receptor Coactivator 4, ARA70, DKFZp762E1112, ELE1, PTC3, RFG) (FITC)

Gene Names
NCOA4; RFG; ELE1; PTC3; ARA70
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
NCOA4; Monoclonal Antibody; NCOA4 (Nuclear Receptor Coactivator 4; ARA70; DKFZp762E1112; ELE1; PTC3; RFG) (FITC); Nuclear Receptor Coactivator 4; RFG; anti-NCOA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B7
Specificity
Recognizes NCOA4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NCOA4 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NCOA4 (NP_005428, 505aa-614aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(NCOA4 monoclonal antibody (M04), clone 1B7 Western Blot analysis of NCOA4 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (NCOA4 monoclonal antibody (M04), clone 1B7 Western Blot analysis of NCOA4 expression in NIH/3T3 (Cat # L018V1).)

Testing Data

(Detection limit for recombinant GST tagged NCOA4 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NCOA4 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-NCOA4 antibody
This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq]
Product Categories/Family for anti-NCOA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
nuclear receptor coactivator 4 isoform 3
NCBI Official Synonym Full Names
nuclear receptor coactivator 4
NCBI Official Symbol
NCOA4
NCBI Official Synonym Symbols
RFG; ELE1; PTC3; ARA70
NCBI Protein Information
nuclear receptor coactivator 4
UniProt Protein Name
Nuclear receptor coactivator 4
UniProt Gene Name
NCOA4
UniProt Synonym Gene Names
ARA70; ELE1; RFG; NCoA-4; 70 kDa AR-activator
UniProt Entry Name
NCOA4_HUMAN

NCBI Description

This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009]

Uniprot Description

NCOA4: Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma. Defects in NCOA4 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving NCOA4 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q11.2) generates the RET/NCOA4 (PTC3) oncogene that has been found in sporadic and radiation-associated post-Chernobyl thyroid papillary carcinomas. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Oncoprotein

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: nucleus

Molecular Function: androgen receptor binding; transcription coactivator activity

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; male gonad development; response to hormone stimulus

Disease: Thyroid Carcinoma, Papillary

Research Articles on NCOA4

Similar Products

Product Notes

The NCOA4 ncoa4 (Catalog #AAA6176475) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NCOA4 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCOA4 ncoa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCOA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.