Mouse anti-Human NCAPG Monoclonal Antibody | anti-NCAPG antibody

NCAPG (Condensin Complex Subunit 3, Chromosome-associated Protein G, Condensin Subunit CAP-G, hCAP-G, Melanoma Antigen NY-MEL-3, Non-SMC Condensin I Complex Subunit G, XCAP-G Homolog, CAPG, NYMEL3) APC

Cat. Num. AAA6137798

• Gene Names: NCAPG; CAPG; CHCG; YCG1; NY-MEL-3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NCAPG; Monoclonal Antibody; NCAPG (Condensin Complex Subunit 3; Chromosome-associated Protein G; Condensin Subunit CAP-G; hCAP-G; Melanoma Antigen NY-MEL-3; Non-SMC Condensin I Complex Subunit G; XCAP-G Homolog; CAPG; NYMEL3) APC; anti-NCAPG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B1
• Specificity: Recognizes human NCAPG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-NCAPG antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa336-435 from human NCAPG (AAH00827) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(HCAP-G monoclonal antibody, Western Blot analysis of HCAP-G expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HCAP-G on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HCAP-G is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-NCAPG antibody

Antibodies; Cell Division

NCBI and Uniprot Product Information

• NCBI GI #: 12654044
• NCBI GeneID: 64151
• Molecular Weight: 114,334 Da
• NCBI Official Full Name: Homo sapiens non-SMC condensin I complex, subunit G, mRNA
• NCBI Official Synonym Full Names: non-SMC condensin I complex subunit G
• NCBI Official Symbol: NCAPG
• NCBI Official Synonym Symbols: CAPG; CHCG; YCG1; NY-MEL-3
• NCBI Protein Information: condensin complex subunit 3

NCBI Description

This gene encodes a subunit of the condensin complex, which is responsible for the condensation and stabilization of chromosomes during mitosis and meiosis. Phosphorylation of the encoded protein activates the condensin complex. There are pseudogenes for this gene on chromosomes 8 and 15. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]