Western Blot (WB)
(Western Blot detection against Immunogen (63.51kD).)
Mouse anti-Human NCAPD3 Monoclonal Antibody | anti-NCAPD3 antibody
NCAPD3 (CAPD3, KIAA0056, Condensin-2 Complex Subunit D3, Non-SMC Condensin II Complex Subunit D3) (FITC)
Gene Names
NCAPD3; CAPD3; hcp-6; CAP-D3; hHCP-6; hCAP-D3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NCAPD3; Monoclonal Antibody; NCAPD3 (CAPD3; KIAA0056; Condensin-2 Complex Subunit D3; Non-SMC Condensin II Complex Subunit D3) (FITC); anti-NCAPD3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D5
Specificity
Recognizes human KIAA0056.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NCAPD3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 2ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-341 from KIAA0056 (AAH11408) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (63.51kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (63.51kD).)
Western Blot (WB)
(KIAA0056 monoclonal antibody Western Blot analysis of KIAA0056 expression in Hela NE.)
Western Blot (WB)
(KIAA0056 monoclonal antibody Western Blot analysis of KIAA0056 expression in Hela NE.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to KIAA0056 on formalin-fixed paraffin-embedded human breast cancer tissue.[antibody concentration 2ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to KIAA0056 on formalin-fixed paraffin-embedded human breast cancer tissue.[antibody concentration 2ug/ml])
Product Categories/Family for anti-NCAPD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
168,891 Da
NCBI Official Full Name
Homo sapiens non-SMC condensin II complex, subunit D3, mRNA
NCBI Official Synonym Full Names
non-SMC condensin II complex subunit D3
NCBI Official Symbol
NCAPD3
NCBI Official Synonym Symbols
CAPD3; hcp-6; CAP-D3; hHCP-6; hCAP-D3
NCBI Protein Information
condensin-2 complex subunit D3
Protein Family
NCBI Description
Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPD3 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM, Mar 2008]
Research Articles on NCAPD3
Similar Products
Product Notes
The NCAPD3 (Catalog #AAA6148403) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCAPD3 (CAPD3, KIAA0056, Condensin-2 Complex Subunit D3, Non-SMC Condensin II Complex Subunit D3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCAPD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCAPD3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCAPD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
