Mouse anti-Human NBR1 Monoclonal Antibody | anti-NBR1 antibody

NBR1 (Next To BRCA1 Gene 1 Protein, Neighbor Of BRCA1 Gene 1 Protein, Membrane Component Chromosome 17 Surface Marker 2, Protein 1A1-3B, Cell Migration-Inducing Gene 19 Protein, 1A13B, KIAA0049, M17S2, MIG19) (AP)

Cat. Num. AAA6132492

• Gene Names: NBR1; IAI3B; M17S2; MIG19; 1A1-3B
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NBR1; Monoclonal Antibody; NBR1 (Next To BRCA1 Gene 1 Protein; Neighbor Of BRCA1 Gene 1 Protein; Membrane Component Chromosome 17 Surface Marker 2; Protein 1A1-3B; Cell Migration-Inducing Gene 19 Protein; 1A13B; KIAA0049; M17S2; MIG19) (AP); anti-NBR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5C3
• Specificity: Recognizes human NBR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-NBR1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-96 from human NBR1 (NP_005890) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB)

(Western Blot analysis of NBR1 expression in transfected 293T cell line by NBR1 monoclonal antibody. Lane 1: NBR1 transfected lysate (107.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NBR1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of NBR1 over-expressed 293 cell line, cotransfected with NBR1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NBR1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-NBR1 antibody

Next to BRCA1 gene 1 (NBR1) protein is known for its encoding gene proximity to the BRCA1 tumor suppressor gene. N-terminal Phox and Bem1p (PB1) domains of NBR1 mediate its interaction with muscle specific tintin kinase and scaffolding protein p62. NBR1 plays a role in autophagy by facilitating the autophagosomal degradation of ubiquitinated proteins independently and also in concert with p62.

Product Categories/Family for anti-NBR1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 14110375
• NCBI GeneID: 4077
• NCBI Accession #: NP_005890
• NCBI GenBank Nucleotide #: NM_005899
• UniProt Accession #: Q5J7Q8; Q13173; Q15026; Q96GB6; Q9NRF7; Q14596
• Molecular Weight: 103,834 Da
• NCBI Official Full Name: next to BRCA1 gene 1 protein isoform a
• NCBI Official Synonym Full Names: neighbor of BRCA1 gene 1
• NCBI Official Symbol: NBR1
• NCBI Official Synonym Symbols: IAI3B; M17S2; MIG19; 1A1-3B
• NCBI Protein Information: next to BRCA1 gene 1 protein; B-box protein; cell migration-inducing gene 19 protein; membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); migration-inducing protein 19
• UniProt Protein Name: Next to BRCA1 gene 1 protein
• Protein Family: Next to BRCA1 gene 1 protein
• UniProt Gene Name: NBR1
• UniProt Synonym Gene Names: 1A13B; KIAA0049; M17S2
• UniProt Entry Name: NBR1_HUMAN