Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NARG1 is 0.03 ng/ml as a capture antibody.)

Mouse NARG1 Monoclonal Antibody | anti-NARG1 antibody

NARG1 (NMDA Receptor Regulated 1, Ga19, NATH, TBDN100) (PE)

Gene Names
NAA15; Ga19; NATH; NARG1; TBDN100
Applications
Western Blot
Purity
Purified
Synonyms
NARG1; Monoclonal Antibody; NARG1 (NMDA Receptor Regulated 1; Ga19; NATH; TBDN100) (PE); NMDA Receptor Regulated 1; TBDN100; anti-NARG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A11
Specificity
Recognizes NARG1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NARG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NARG1 (NP_476516.1, 764aa-862aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NARG1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NARG1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-NARG1 antibody
This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeq]
Product Categories/Family for anti-NARG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,272 Da
NCBI Official Full Name
N-alpha-acetyltransferase 15, NatA auxiliary subunit
NCBI Official Synonym Full Names
N(alpha)-acetyltransferase 15, NatA auxiliary subunit
NCBI Official Symbol
NAA15
NCBI Official Synonym Symbols
Ga19; NATH; NARG1; TBDN100
NCBI Protein Information
N-alpha-acetyltransferase 15, NatA auxiliary subunit; tubedown-1; protein tubedown-1; NMDA receptor regulated 1; gastric cancer antigen Ga19; N-terminal acetyltransferase; NMDA receptor-regulated protein 1; transcriptional coactivator tubedown-100
UniProt Protein Name
N-alpha-acetyltransferase 15, NatA auxiliary subunit
UniProt Gene Name
NAA15
UniProt Synonym Gene Names
GA19; NARG1; NATH; TBDN100
UniProt Entry Name
NAA15_HUMAN

NCBI Description

This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeq, Jul 2008]

Uniprot Description

NAA15: The NAA10-NAA15 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Acetyltransferase

Chromosomal Location of Human Ortholog: 4q31.1

Cellular Component: transcription factor complex; membrane; cytoplasm; nucleus

Molecular Function: N-acetyltransferase activity; protein binding; acetyltransferase activity; ribosome binding

Biological Process: N-terminal protein amino acid acetylation; protein stabilization; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; angiogenesis; cell differentiation; negative regulation of apoptosis

Research Articles on NARG1

Similar Products

Product Notes

The NARG1 naa15 (Catalog #AAA6187774) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NARG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NARG1 naa15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NARG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.