Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NANOS1 is 0.03 ng/ml as a capture antibody.)

Mouse NANOS1 Monoclonal Antibody | anti-NANOS1 antibody

NANOS1 (Nanos Homolog 1 (Drosophila), NOS1) (APC)

Gene Names
NANOS1; NOS1; SPGF12
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
NANOS1; Monoclonal Antibody; NANOS1 (Nanos Homolog 1 (Drosophila); NOS1) (APC); Nanos Homolog 1 (Drosophila); NOS1; anti-NANOS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5F12
Specificity
Recognizes NANOS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NANOS1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NANOS1 (NP_955631.1, 206aa-270aa) partial recombinant protein with GST tag.
Immunogen Sequence
LLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NANOS1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NANOS1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-NANOS1 antibody
Mouse monoclonal antibody raised against a partial recombinant NANOS1.
Product Categories/Family for anti-NANOS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,230 Da
NCBI Official Full Name
nanos homolog 1
NCBI Official Synonym Full Names
nanos homolog 1 (Drosophila)
NCBI Official Symbol
NANOS1
NCBI Official Synonym Symbols
NOS1; SPGF12
NCBI Protein Information
nanos homolog 1; NOS-1; EC_Rep1a
UniProt Protein Name
Nanos homolog 1
Protein Family
UniProt Gene Name
NANOS1
UniProt Synonym Gene Names
NOS1; NOS-1
UniProt Entry Name
NANO1_HUMAN

NCBI Description

This gene encodes a CCHC-type zinc finger protein that is a member of the nanos family. This protein co-localizes with the RNA-binding protein pumilio RNA-binding family member 2 and may be involved in regulating translation as a post-transcriptional repressor. Mutations in this gene are associated with spermatogenic impairment. [provided by RefSeq, Sep 2015]

Uniprot Description

NANOS1: May act as a translational repressor which regulates translation of specific mRNAs by forming a complex with PUM2 that associates with the 3'-UTR of mRNA targets. Capable of interfering with the proadhesive and anti-invasive functions of E-cadherin. Up-regulates the production of MMP14 to promote tumor cell invasion. Belongs to the nanos family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q26.11

Cellular Component: perinuclear region of cytoplasm; cytoplasm

Molecular Function: protein binding; translation repressor activity; zinc ion binding; RNA binding

Biological Process: cell migration; negative regulation of translation

Disease: Spermatogenic Failure 12

Research Articles on NANOS1

Similar Products

Product Notes

The NANOS1 nanos1 (Catalog #AAA6170342) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NANOS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NANOS1 nanos1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NANOS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.