Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MZF1 Monoclonal Antibody | anti-MZF1 antibody

MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6)

Gene Names
MZF1; MZF-1; MZF1B; ZFP98; ZNF42; ZSCAN6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MZF1; Monoclonal Antibody; MZF1 (Myeloid Zinc Finger 1; MZF-1; Zinc Finger and SCAN Domain-containing Protein 6; Zinc Finger Protein 42; MZF; ZNF42; ZSCAN6); Anti -MZF1 (Myeloid Zinc Finger 1; anti-MZF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F7
Specificity
Recognizes human MZF1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVEC*
Applicable Applications for anti-MZF1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in Western Blot and ELISA.
Immunogen
Partial recombinant corresponding to aa419-519 of human MZF1 (NP_003413) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(MZF1 monoclonal antibody. Western Blot analysis of MZF1 expression in Hela NE.)

Western Blot (WB) (MZF1 monoclonal antibody. Western Blot analysis of MZF1 expression in Hela NE.)
Related Product Information for anti-MZF1 antibody
Binds to target promoter DNA and functions as trancription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development.
Product Categories/Family for anti-MZF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,055 Da
NCBI Official Full Name
myeloid zinc finger 1 isoform 2
NCBI Official Synonym Full Names
myeloid zinc finger 1
NCBI Official Symbol
MZF1
NCBI Official Synonym Symbols
MZF-1; MZF1B; ZFP98; ZNF42; ZSCAN6
NCBI Protein Information
myeloid zinc finger 1; zinc finger and SCAN domain-containing protein 6; zinc finger protein 42 (myeloid-specific retinoic acid-responsive)
UniProt Protein Name
Myeloid zinc finger 1
Protein Family
UniProt Gene Name
MZF1
UniProt Synonym Gene Names
MZF; ZNF42; ZSCAN6; MZF-1
UniProt Entry Name
MZF1_HUMAN

Uniprot Description

MZF-1: Binds to target promoter DNA and functions as trancription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: nucleus

Molecular Function: protein binding; protein homodimerization activity; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter

Research Articles on MZF1

Similar Products

Product Notes

The MZF1 mzf1 (Catalog #AAA6004141) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MZF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in Western Blot and ELISA. Researchers should empirically determine the suitability of the MZF1 mzf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QGFVRSARLE EHRRVHTGEQ PFRCAECGQS FRQRSNLLQH QRIHGDPPGP GAKPPAPPGA PEPPGPFPCS ECRESFARRA VLLEHQAVHT GDKSFGCVEC *. It is sometimes possible for the material contained within the vial of "MZF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.