Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Mouse anti-Human MYST3 Monoclonal Antibody | anti-MYST3 antibody

MYST3 (Histone Acetyltransferase KAT6A, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 3, MYST-3, Monocytic Leukemia Zinc Finger Protein, Runt-related Transcription Factor-binding Protein 2, Zinc Finger Protein 220, KAT6A, MOZ, RUNXBP2, ZNF220, MGC167033) (HRP)

Gene Names
KAT6A; MOZ; MRD32; MYST3; MYST-3; ZNF220; RUNXBP2; ZC2HC6A
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYST3; Monoclonal Antibody; MYST3 (Histone Acetyltransferase KAT6A; MOZ; YBF2/SAS3; SAS2 and TIP60 Protein 3; MYST-3; Monocytic Leukemia Zinc Finger Protein; Runt-related Transcription Factor-binding Protein 2; Zinc Finger Protein 220; KAT6A; RUNXBP2; ZNF220; MGC167033) (HRP); anti-MYST3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D8
Specificity
Recognizes human MYST3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MYST3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-180 from MYST3 (NP_006757) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged MYST3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MYST3 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-MYST3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
225,028 Da
NCBI Official Full Name
histone acetyltransferase KAT6A isoform 1
NCBI Official Synonym Full Names
K(lysine) acetyltransferase 6A
NCBI Official Symbol
KAT6A
NCBI Official Synonym Symbols
MOZ; MRD32; MYST3; MYST-3; ZNF220; RUNXBP2; ZC2HC6A
NCBI Protein Information
histone acetyltransferase KAT6A

NCBI Description

This gene encodes a member of the MOZ, YBFR2, SAS2, TIP60 family of histone acetyltransferases. The protein is composed of a nuclear localization domain, a double C2H2 zinc finger domain that binds to acetylated histone tails, a histone acetyl-transferase domain, a glutamate/aspartate-rich region, and a serine- and methionine-rich transactivation domain. It is part of a complex that acetylates lysine-9 residues in histone 3, and in addition, it acts as a co-activator for several transcription factors. Allelic variants of this gene are associated with autosomal dominant mental retardation-32. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Research Articles on MYST3

Similar Products

Product Notes

The MYST3 (Catalog #AAA6153682) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYST3 (Histone Acetyltransferase KAT6A, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 3, MYST-3, Monocytic Leukemia Zinc Finger Protein, Runt-related Transcription Factor-binding Protein 2, Zinc Finger Protein 220, KAT6A, MOZ, RUNXBP2, ZNF220, MGC167033) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYST3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYST3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYST3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.