Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human MYOZ1 Monoclonal Antibody | anti-MYOZ1 antibody

MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) (FITC)

Gene Names
MYOZ1; CS-2; FATZ; MYOZ
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYOZ1; Monoclonal Antibody; MYOZ1 (Myozenin 1; Myozenin-1; Calsarcin-2; MYOZ Filamin-; actinin- and telethonin-binding Protein; Protein FATZ) (FITC); anti-MYOZ1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E8
Specificity
Recognizes human MYOZ1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MYOZ1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa200-299 from human MYOZ1 (NP_067068) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MYOZ1 monoclonal antibody. Western Blot analysis of MYOZ1 expression in HepG2.)

Western Blot (WB) (MYOZ1 monoclonal antibody. Western Blot analysis of MYOZ1 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged MYOZ1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MYOZ1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-MYOZ1 antibody
Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. MYOZ (Myozenin 1) plays an important role in the modulation of calcineurin signaling. MYOZ1 may play a role in myofibrillogenesis. MYOZ1 interacts with ACTN2, ACTN3, FLNA, FLNB, FLNC, LDB3, PPP3CA and TCAP and interacts via its C-terminal region with MYOT. MYOZ1 is localized to the nucleus and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. MYOZ1 colocalizes with ACTN2, FLNC and MYOT at the Z-lines of skeletal muscle. MYOZ1 is expressed primarily in skeletal muscle and specifically enriched in the gastrocnemius, which is composed predominantly of fast-twitch muscle fibers.
Product Categories/Family for anti-MYOZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,745 Da
NCBI Official Full Name
myozenin-1
NCBI Official Synonym Full Names
myozenin 1
NCBI Official Symbol
MYOZ1
NCBI Official Synonym Symbols
CS-2; FATZ; MYOZ
NCBI Protein Information
myozenin-1; MYOZ1; calsarcin-2; filamin-, actinin- and telethonin-binding protein
UniProt Protein Name
Myozenin-1
Protein Family
UniProt Gene Name
MYOZ1
UniProt Entry Name
MYOZ1_HUMAN

NCBI Description

The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]

Uniprot Description

MYOZ1: Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma- filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis. Belongs to the myozenin family.

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: pseudopodium; nucleus; actin cytoskeleton

Molecular Function: protein binding; FATZ binding

Biological Process: myofibril assembly

Research Articles on MYOZ1

Similar Products

Product Notes

The MYOZ1 myoz1 (Catalog #AAA6148375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYOZ1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYOZ1 myoz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYOZ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.