Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human Myoglobin Monoclonal Antibody | anti-MB antibody

Myoglobin (MB) (FITC)

Gene Names
MB; PVALB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Myoglobin; Monoclonal Antibody; Myoglobin (MB) (FITC); anti-MB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F8
Specificity
Recognizes human MB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MB antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from human MB (NP_005359.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of MB expression in transfected 293T cell line by MB monoclonal antibody. Lane 1: MB transfected lysate (17.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MB expression in transfected 293T cell line by MB monoclonal antibody. Lane 1: MB transfected lysate (17.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MB is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MB is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-MB antibody
Myoglobin is a cytoplasmic single chain polypeptide that contains a single heme group and functions as an oxygen transporting pigment. It is found in skeletal and cardiac muscle but not smooth muscle. This antibody does not recognize hemoglobin and may help in detecting tissues of striated muscle origin.
Product Categories/Family for anti-MB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,184 Da
NCBI Official Full Name
myoglobin
NCBI Official Synonym Full Names
myoglobin
NCBI Official Symbol
MB
NCBI Official Synonym Symbols
PVALB
NCBI Protein Information
myoglobin
UniProt Protein Name
Myoglobin
Protein Family
UniProt Gene Name
MB
UniProt Entry Name
MYG_HUMAN

NCBI Description

This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

MB: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Belongs to the globin family.

Protein type: Carrier

Chromosomal Location of Human Ortholog: 22q13.1

Molecular Function: iron ion binding; heme binding; oxygen binding; oxygen transporter activity

Biological Process: slow-twitch skeletal muscle fiber contraction; response to hydrogen peroxide; oxygen transport; heart development; response to hormone stimulus; response to hypoxia; brown fat cell differentiation; enucleate erythrocyte differentiation

Research Articles on MB

Similar Products

Product Notes

The MB mb (Catalog #AAA6148371) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Myoglobin (MB) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Myoglobin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MB mb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Myoglobin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.