Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human MYLK Monoclonal Antibody | anti-MYLK antibody

MYLK (Myosin Light Chain Kinase, Smooth Muscle, MLCK, smMLCK, Kinase-related Protein, KRP, Telokin, MLCK, MLCK1, MYLK1, DKFZp686I10125, FLJ12216) (HRP)

Gene Names
MYLK; KRP; AAT7; MLCK; MLCK1; MMIHS; MYLK1; smMLCK; MLCK108; MLCK210; MSTP083
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYLK; Monoclonal Antibody; MYLK (Myosin Light Chain Kinase; Smooth Muscle; MLCK; smMLCK; Kinase-related Protein; KRP; Telokin; MLCK1; MYLK1; DKFZp686I10125; FLJ12216) (HRP); anti-MYLK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D1
Specificity
Recognizes human MYLK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1914
Applicable Applications for anti-MYLK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1710-1809 from human MYLK (NP_444253) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of MYLK expression in transfected 293T cell line by MYLK monoclonal antibody Lane 1: MYLK transfected lysate (110.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MYLK expression in transfected 293T cell line by MYLK monoclonal antibody Lane 1: MYLK transfected lysate (110.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MYLK antibody
MLCK, a member of the Ser/Thr protein kinase family, is a calcium/calmodulin-dependent enzyme responsible for smooth muscle contraction via phosphorylation of a specific serine in the N-terminus of myosin light chains (MLC), an event that facilitates myosin interaction with actin filaments. It is a central determinant in the development of vascular permeability and tissue edema formation. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. MLCK acts as a critical participant in signaling sequences that result in fibroblast apoptosis. Smooth muscle and non-muscle isozymes are expressed in a wide variety of adult and fetal tissues and in cultured endothelium with qualitative expression appearing to be neither tissue- nor development-specific. Non-muscle isoform 2 is the dominant splice variant expressed in various tissues. The Telokin isoform, which binds calmodulin, has been found in a wide variety of adult and fetal tissues. MLCK is probably down-regulated by phosphorylation. The protein contains 1 fibronectin type III domain and 9 immunoglobulin-like C2-type domains.
Product Categories/Family for anti-MYLK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
myosin light chain kinase, smooth muscle isoform 1
NCBI Official Synonym Full Names
myosin light chain kinase
NCBI Official Symbol
MYLK
NCBI Official Synonym Symbols
KRP; AAT7; MLCK; MLCK1; MMIHS; MYLK1; smMLCK; MLCK108; MLCK210; MSTP083
NCBI Protein Information
myosin light chain kinase, smooth muscle
UniProt Protein Name
Myosin light chain kinase, smooth muscle
Protein Family
UniProt Gene Name
MYLK
UniProt Synonym Gene Names
MLCK; MLCK1; MYLK1; MLCK; smMLCK; KRP
UniProt Entry Name
MYLK_HUMAN

NCBI Description

This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium/calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3' region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium/calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts. [provided by RefSeq, Jul 2008]

Uniprot Description

smMLCK: Calcium/calmodulin-dependent myosin light chain kinase implicated in smooth muscle contraction via phosphorylation of myosin light chains (MLC). Also regulates actin-myosin interaction through a non-kinase activity. Phosphorylates PTK2B/PYK2 and myosin light-chains. Involved in the inflammatory response (e.g. apoptosis, vascular permeability, leukocyte diapedesis), cell motility and morphology, airway hyperreactivity and other activities relevant to asthma. Required for tonic airway smooth muscle contraction that is necessary for physiological and asthmatic airway resistance. Necessary for gastrointestinal motility. Implicated in the regulation of endothelial as well as vascular permeability, probably via the regulation of cytoskeletal rearrangements. In the nervous system it has been shown to control the growth initiation of astrocytic processes in culture and to participate in transmitter release at synapses formed between cultured sympathetic ganglion cells. Critical participant in signaling sequences that result in fibroblast apoptosis. Plays a role in the regulation of epithelial cell survival. Required for epithelial wound healing, especially during actomyosin ring contraction during purse-string wound closure. Mediates RhoA- dependent membrane blebbing. Triggers TRPC5 channel activity in a calcium-dependent signaling, by inducing its subcellular localization at the plasma membrane. Promotes cell migration (including tumor cells) and tumor metastasis. PTK2B/PYK2 activation by phosphorylation mediates ITGB2 activation and is thus essential to trigger neutrophil transmigration during acute lung injury (ALI). May regulate optic nerve head astrocyte migration. Probably involved in mitotic cytoskeletal regulation. Regulates tight junction probably by modulating ZO-1 exchange in the perijunctional actomyosin ring. Mediates burn-induced microvascular barrier injury; triggers endothelial contraction in the development of microvascular hyperpermeability by phosphorylating MLC. Essential for intestinal barrier dysfunction. Mediates Giardia spp.-mediated reduced epithelial barrier function during giardiasis intestinal infection via reorganization of cytoskeletal F-actin and tight junctional ZO-1. Necessary for hypotonicity-induced Ca(2+) entry and subsequent activation of volume-sensitive organic osmolyte/anion channels (VSOAC) in cervical cancer cells. Responsible for high proliferative ability of breast cancer cells through anti-apoptosis. Defects in MYLK are the cause of familial aortic aneurysm thoracic type 7 (AAT7). AAT7 is a disease characterized by permanent dilation of the thoracic aorta usually due to degenerative changes in the aortic wall. It is primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.18; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CAMK; CAMK group; MLCK family

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: lamellipodium; cytoplasm; stress fiber; intercellular junction; cytosol; cleavage furrow

Molecular Function: calmodulin binding; protein binding; calmodulin-dependent protein kinase activity; metal ion binding; actin binding; ATP binding; myosin light chain kinase activity

Biological Process: tonic smooth muscle contraction; smooth muscle contraction; muscle contraction; actin filament organization; bleb formation; positive regulation of calcium ion transport; protein amino acid phosphorylation; positive regulation of cell migration

Disease: Aortic Aneurysm, Familial Thoracic 7

Research Articles on MYLK

Similar Products

Product Notes

The MYLK mylk (Catalog #AAA6153665) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYLK (Myosin Light Chain Kinase, Smooth Muscle, MLCK, smMLCK, Kinase-related Protein, KRP, Telokin, MLCK, MLCK1, MYLK1, DKFZp686I10125, FLJ12216) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYLK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYLK mylk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYLK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.