Mouse anti-Human MYBPC1 Monoclonal Antibody | anti-MYBPC1 antibody

MYBPC1 (Myosin-binding Protein C, Slow-type, Slow MyBP-C, C-protein, Skeletal Muscle Slow Isoform, MYBPCS) (Biotin)

Cat. Num. AAA6143045

• Gene Names: MYBPC1; LCCS4; MYBPCC; MYBPCS; MYOTREM; ssMyBP-C
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MYBPC1; Monoclonal Antibody; MYBPC1 (Myosin-binding Protein C; Slow-type; Slow MyBP-C; C-protein; Skeletal Muscle Slow Isoform; MYBPCS) (Biotin); anti-MYBPC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G4
• Specificity: Recognizes human MYBPC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1141

• Applicable Applications for anti-MYBPC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa506-603 from human MYBPC1 (NP_996556) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged MYBPC1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-MYBPC1 antibody

Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.

Product Categories/Family for anti-MYBPC1 antibody

Antibodies; Binding Proteins

References

1. Myosin Binding Protein C Slow is a Novel Substrate for Protein Kinase A (PKA) and C (PKC) in Skeletal Muscle. Ackermann MA, Kontrogianni-Konstantopoulos A.J Proteome Res. 2011 Sep 4. 2. Myosin Binding Protein-C Slow: An Intricate Subfamily of Proteins. Ackermann MA, Kontrogianni-Konstantopoulos A.J Biomed Biotechnol. 2010;2010:652065. Epub 2010 Apr 8.

NCBI and Uniprot Product Information

• NCBI GI #: 46049119
• NCBI GeneID: 4604
• NCBI Accession #: NP_996556
• NCBI GenBank Nucleotide #: NM_206820
• UniProt Accession #: Q00872
• NCBI Official Full Name: myosin-binding protein C, slow-type isoform 3
• NCBI Official Synonym Full Names: myosin binding protein C1
• NCBI Official Symbol: MYBPC1
• NCBI Official Synonym Symbols: LCCS4; MYBPCC; MYBPCS; MYOTREM; ssMyBP-C
• NCBI Protein Information: myosin-binding protein C, slow-type
• UniProt Protein Name: Myosin-binding protein C, slow-type
• Protein Family: Myosin-binding protein
• UniProt Gene Name: MYBPC1
• UniProt Synonym Gene Names: MYBPCS; Slow MyBP-C
• UniProt Entry Name: MYPC1_HUMAN

NCBI Description

This gene encodes a member of the myosin-binding protein C family. Myosin-binding protein C family members are myosin-associated proteins found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The encoded protein is the slow skeletal muscle isoform of myosin-binding protein C and plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments. Mutations in this gene are associated with distal arthrogryposis type I. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

MYBPC1: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Defects in MYBPC1 are the cause of arthrogryposis, distal, type 1B (DA1B). A form of distal arthrogryposis, a disease characterized by congenital joint contractures that mainly involve two or more distal parts of the limbs, in the absence of a primary neurological or muscle disease. Distal arthrogryposis type 1 is characterized largely by camptodactyly and clubfoot. Hypoplasia and/or absence of some interphalangeal creases is common. The shoulders and hips are less frequently affected. Defects in MYBPC1 may be a cause of autosomal recessive lethal congenital contractural syndrome (LCCS), a severe, neonatally lethal form of arthrogryposis. Belongs to the immunoglobulin superfamily. MyBP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Myosin-binding

Chromosomal Location of Human Ortholog: 12q23.2

Cellular Component: myofibril; cytosol

Molecular Function: protein binding; structural constituent of muscle; titin binding; actin binding

Biological Process: cell adhesion; muscle filament sliding

Disease: Lethal Congenital Contracture Syndrome 4; Arthrogryposis, Distal, Type 1b