Mouse anti-Human MYBL2 Monoclonal Antibody | anti-MYBL2 antibody

MYBL2 (Myb-related Protein B, B-Myb, Myb-like Protein 2, BMYB, MGC15600) (HRP)

Cat. Num. AAA6153650

• Gene Names: MYBL2; BMYB; B-MYB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MYBL2; Monoclonal Antibody; MYBL2 (Myb-related Protein B; B-Myb; Myb-like Protein 2; BMYB; MGC15600) (HRP); anti-MYBL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C7
• Specificity: Recognizes human MYBL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2673

• Applicable Applications for anti-MYBL2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa601-700 from human MYBL2 (AAH53555) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(MYBL2 monoclonal antibody Western Blot analysis of MYBL2 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MYBL2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MYBL2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-MYBL2 antibody

Transcription factor involved in the regulation of cell survival, proliferation, and differentiation. Transactivates the expression of the CLU gene.

Product Categories/Family for anti-MYBL2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31565775
• NCBI GeneID: 4605
• NCBI Official Full Name: Homo sapiens v-myb myeloblastosis viral oncogene homolog (avian)-like 2, mRNA
• NCBI Official Synonym Full Names: MYB proto-oncogene like 2
• NCBI Official Symbol: MYBL2
• NCBI Official Synonym Symbols: BMYB; B-MYB
• NCBI Protein Information: myb-related protein B
• Protein Family: Myb-related protein

NCBI Description

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]