Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human MVD Monoclonal Antibody | anti-MVD antibody

MVD (Mevalonate Pyrophosphate Decarboxylase, MPD, Diphosphomevalonate Decarboxylase, FP17780, Mevalonate (Diphospho) Decarboxylase, MDDase) APC

Gene Names
MVD; MPD; MDDase; POROK7; FP17780
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MVD; Monoclonal Antibody; MVD (Mevalonate Pyrophosphate Decarboxylase; MPD; Diphosphomevalonate Decarboxylase; FP17780; Mevalonate (Diphospho) Decarboxylase; MDDase) APC; anti-MVD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A7
Specificity
Recognizes human MVD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MVD antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa301-398 from human MVD (NP_002452) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(MVD monoclonal antibody Western Blot analysis of MVD expression in A-431.)

Western Blot (WB) (MVD monoclonal antibody Western Blot analysis of MVD expression in A-431.)

Western Blot (WB)

(Western Blot analysis of MVD expression in transfected 293T cell line by MVD monoclonal antibody. Lane 1: MVD transfected lysate (43.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MVD expression in transfected 293T cell line by MVD monoclonal antibody. Lane 1: MVD transfected lysate (43.4kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MVD on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MVD on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MVD is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MVD is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-MVD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45.6 kDa (420aa), confirmed by MALDI-TOF
NCBI Official Full Name
diphosphomevalonate decarboxylase
NCBI Official Synonym Full Names
mevalonate diphosphate decarboxylase
NCBI Official Symbol
MVD
NCBI Official Synonym Symbols
MPD; MDDase; POROK7; FP17780
NCBI Protein Information
diphosphomevalonate decarboxylase
UniProt Protein Name
Diphosphomevalonate decarboxylase
UniProt Gene Name
MVD
UniProt Synonym Gene Names
MPD; MDDase
UniProt Entry Name
MVD1_HUMAN

NCBI Description

The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP. [provided by RefSeq, Jul 2008]

Uniprot Description

MVD: Performs the first committed step in the biosynthesis of isoprenes. Belongs to the diphosphomevalonate decarboxylase family.

Protein type: Lyase; Secondary Metabolites Metabolism - terpenoid backbone biosynthesis; EC 4.1.1.33

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: peroxisome; cytosol

Molecular Function: diphosphomevalonate decarboxylase activity; protein homodimerization activity; Hsp70 protein binding; ATP binding

Biological Process: cellular protein metabolic process; isoprenoid biosynthetic process; isopentenyl diphosphate biosynthetic process, mevalonate pathway; dolichol-linked oligosaccharide biosynthetic process; positive regulation of cell proliferation; dolichyl diphosphate biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; cholesterol biosynthetic process

Research Articles on MVD

Similar Products

Product Notes

The MVD mvd (Catalog #AAA6137737) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MVD (Mevalonate Pyrophosphate Decarboxylase, MPD, Diphosphomevalonate Decarboxylase, FP17780, Mevalonate (Diphospho) Decarboxylase, MDDase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MVD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MVD mvd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MVD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.