Mouse anti-Human MUSK Monoclonal Antibody | anti-MUSK antibody

MUSK (Muscle, Skeletal Receptor Tyrosine-protein Kinase, Muscle-specific Tyrosine-protein Kinase Receptor, MGC126323, MGC126324) (PE)

Cat. Num. AAA6158947

• Gene Names: MUSK; CMS9; FADS; FADS1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MUSK; Monoclonal Antibody; MUSK (Muscle; Skeletal Receptor Tyrosine-protein Kinase; Muscle-specific Tyrosine-protein Kinase Receptor; MGC126323; MGC126324) (PE); anti-MUSK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2H6
• Specificity: Recognizes human MUSK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 869

• Applicable Applications for anti-MUSK antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-400 from human MUSK (NP_005583) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(MUSK monoclona antibody Western Blot analysis of MUSK expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MUSK on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MUSK is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-MUSK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5031927
• NCBI GeneID: 4593
• NCBI Accession #: NP_005583
• NCBI GenBank Nucleotide #: NM_005592
• UniProt Accession #: O15146
• NCBI Official Full Name: muscle, skeletal receptor tyrosine-protein kinase isoform 1
• NCBI Official Synonym Full Names: muscle associated receptor tyrosine kinase
• NCBI Official Symbol: MUSK
• NCBI Official Synonym Symbols: CMS9; FADS; FADS1
• NCBI Protein Information: muscle, skeletal receptor tyrosine-protein kinase
• UniProt Protein Name: Muscle, skeletal receptor tyrosine-protein kinase
• Protein Family: Muskelin
• UniProt Gene Name: MUSK
• UniProt Synonym Gene Names: MuSK
• UniProt Entry Name: MUSK_HUMAN

NCBI Description

This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Oct 2009]

Uniprot Description

MUSK: a receptor tyrosine kinase that is essential for the establishment and maintenance of the neuromuscular junction (NMJ). Its activation by agrin, a neuronally derived heparan-sulfate proteoglycan, and the agrin receptor (LRP4), leads to clustering of acetylcholine receptors on the postsynaptic side of the NMJ. Its activation by agrin requires Dok7, which interacts with the cytoplasmic portion of MuSK and activates its tyrosine kinase activity.

Protein type: EC 2.7.10.1; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; Membrane protein, integral; TK group; Musk family

Chromosomal Location of Human Ortholog: 9q31.3-q32

Cellular Component: postsynaptic membrane; integral to plasma membrane; cell junction; neuromuscular junction; receptor complex

Molecular Function: protein binding; protein-tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: extracellular matrix organization and biogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; positive regulation of neuron apoptosis; multicellular organismal development; regulation of synaptic growth at neuromuscular junction; positive regulation of protein amino acid phosphorylation; cell differentiation; memory; neuromuscular junction development; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Myasthenic Syndrome, Congenital, 9, Associated With Acetylcholine Receptor Deficiency; Fetal Akinesia Deformation Sequence