Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse Musashi 1/Msi1 Monoclonal Antibody | anti-MSI1 antibody

Anti-Musashi 1/Msi1 Antibody (Monoclonal, 2B9)

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
Musashi 1/Msi1; Monoclonal Antibody; Anti-Musashi 1/Msi1 Antibody (Monoclonal; 2B9); Msi 1; Msi1; Musashi-1; Musashi1; O43347; anti-MSI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
2B9
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
362
Applicable Applications for anti-MSI1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
WB: 0.1-0.5ug/ml (Human, Mouse, Rat)
IHC-P (Embedded Section): 0.5-1ug/ml (Human, Mouse, Rat)
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-MSI1 antibody
Description: Mouse IgG monoclonal antibody for Musashi 1/Msi1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.

Background: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
References
1. Good P, Yoda A, Sakakibara S, Yamamoto A, Imai T, Sawa H, Ikeuchi T, Tsuji S, Satoh H, Okano H (Dec 1998). "The human Musashi homolog 1 (MSI1) gene encoding the homologue of Musashi/Nrp-1, a neural RNA-binding protein putatively expressed in CNS stem cells and neural progenitor cells". Genomics. 52 (3): 382-4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
RNA-binding protein Musashi homolog 1
NCBI Official Synonym Full Names
musashi RNA binding protein 1
NCBI Official Symbol
MSI1
NCBI Protein Information
RNA-binding protein Musashi homolog 1
UniProt Protein Name
RNA-binding protein Musashi homolog 1
Protein Family
UniProt Gene Name
MSI1
UniProt Synonym Gene Names
Musashi-1
UniProt Entry Name
MSI1H_HUMAN

NCBI Description

This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. [provided by RefSeq, Jul 2008]

Research Articles on MSI1

Similar Products

Product Notes

The MSI1 msi1 (Catalog #AAA1753248) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Musashi 1/Msi1 Antibody (Monoclonal, 2B9) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Musashi 1/Msi1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. WB: 0.1-0.5ug/ml (Human, Mouse, Rat) IHC-P (Embedded Section): 0.5-1ug/ml (Human, Mouse, Rat) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the MSI1 msi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Musashi 1/Msi1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.