Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MTRF1 is 1ng/ml as a capture antibody.)

Mouse anti-Human MTRF1 Monoclonal Antibody | anti-MTRF1 antibody

MTRF1 (Peptide Chain Release Factor 1, Mitochondrial, MRF-1, MtRF-1) (HRP)

Gene Names
MTRF1; RF1; MRF1; MTTRF1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTRF1; Monoclonal Antibody; MTRF1 (Peptide Chain Release Factor 1; Mitochondrial; MRF-1; MtRF-1) (HRP); anti-MTRF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D5
Specificity
Recognizes human MTRF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2184
Applicable Applications for anti-MTRF1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from MTRF1 (NP_004285) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MTRF1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MTRF1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-MTRF1 antibody
The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq].
Product Categories/Family for anti-MTRF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens mitochondrial translation release factor 1 (MTRF1), transcript variant 5, mRNA
NCBI Official Synonym Full Names
mitochondrial translation release factor 1
NCBI Official Symbol
MTRF1
NCBI Official Synonym Symbols
RF1; MRF1; MTTRF1
NCBI Protein Information
peptide chain release factor 1, mitochondrial
UniProt Protein Name
Peptide chain release factor 1, mitochondrial
UniProt Gene Name
MTRF1
UniProt Synonym Gene Names
MRF-1; MtRF-1
UniProt Entry Name
RF1M_HUMAN

NCBI Description

The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq, Jul 2008]

Research Articles on MTRF1

Similar Products

Product Notes

The MTRF1 mtrf1 (Catalog #AAA6153635) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTRF1 (Peptide Chain Release Factor 1, Mitochondrial, MRF-1, MtRF-1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTRF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTRF1 mtrf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTRF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.