Mouse anti-Human, Rat MTHFD1L Monoclonal Antibody | anti-MTHFD1L antibody

MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial, Formyltetrahydrofolate Synthetase, FTHFSDC1)

Cat. Num. AAA6011688

• Gene Names: MTHFD1L; FTHFSDC1; MTC1THFS; dJ292B18.2; RP1-292B18.2
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MTHFD1L; Monoclonal Antibody; MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase; Mitochondrial; Formyltetrahydrofolate Synthetase; FTHFSDC1); Anti -MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase; anti-MTHFD1L antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E8
• Specificity: Recognizes human MTHFD1L. Species Crossreactivity: rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG*

• Applicable Applications for anti-MTHFD1L antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa801-900 from human MTHFD1L (NP_056255) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MTHFD1L monoclonal antibody. Western Blot analysis of MTHFD1L expression in PC-12.)

Related Product Information for anti-MTHFD1L antibody

One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM]

Product Categories/Family for anti-MTHFD1L antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 337756507
• NCBI GeneID: 25902
• NCBI Accession #: NP_001229697.1
• NCBI GenBank Nucleotide #: NM_001242768.1
• UniProt Accession #: Q6UB35; Q2TBF3; Q8WVW0; Q96HG8; Q9H789; Q9UFU8
• Molecular Weight: 105,790 Da
• NCBI Official Full Name: monofunctional C1-tetrahydrofolate synthase, mitochondrial isoform 3
• NCBI Official Synonym Full Names: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
• NCBI Official Symbol: MTHFD1L
• NCBI Official Synonym Symbols: FTHFSDC1; MTC1THFS; dJ292B18.2; RP1-292B18.2
• NCBI Protein Information: monofunctional C1-tetrahydrofolate synthase, mitochondrial; 10-formyl-THF synthetase; formyltetrahydrofolate synthetase domain containing 1
• UniProt Protein Name: Monofunctional C1-tetrahydrofolate synthase, mitochondrial
• Protein Family: Monofunctional C1-tetrahydrofolate synthase
• UniProt Gene Name: MTHFD1L
• UniProt Synonym Gene Names: FTHFSDC1
• UniProt Entry Name: C1TM_HUMAN

NCBI Description

The protein encoded by this gene is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion. THF is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

MTHFD1L: May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.4.3; Mitochondrial; Carbohydrate Metabolism - glyoxylate and dicarboxylate; Cofactor and Vitamin Metabolism - one carbon pool by folate; Ligase

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: mitochondrion; membrane; cytosol

Molecular Function: methylenetetrahydrofolate dehydrogenase (NADP+) activity; protein homodimerization activity; formate-tetrahydrofolate ligase activity; methenyltetrahydrofolate cyclohydrolase activity; ATP binding

Biological Process: tetrahydrofolate metabolic process; folic acid and derivative metabolic process; folic acid and derivative biosynthetic process; formate metabolic process; one-carbon compound metabolic process