Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Rat MTHFD1L Monoclonal Antibody | anti-MTHFD1L antibody

MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial, Formyltetrahydrofolate Synthetase, FTHFSDC1)

Gene Names
MTHFD1L; FTHFSDC1; MTC1THFS; dJ292B18.2; RP1-292B18.2
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MTHFD1L; Monoclonal Antibody; MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase; Mitochondrial; Formyltetrahydrofolate Synthetase; FTHFSDC1); Anti -MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase; anti-MTHFD1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E8
Specificity
Recognizes human MTHFD1L. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG*
Applicable Applications for anti-MTHFD1L antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa801-900 from human MTHFD1L (NP_056255) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MTHFD1L monoclonal antibody. Western Blot analysis of MTHFD1L expression in PC-12.)

Western Blot (WB) (MTHFD1L monoclonal antibody. Western Blot analysis of MTHFD1L expression in PC-12.)
Related Product Information for anti-MTHFD1L antibody
One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM]
Product Categories/Family for anti-MTHFD1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105,790 Da
NCBI Official Full Name
monofunctional C1-tetrahydrofolate synthase, mitochondrial isoform 3
NCBI Official Synonym Full Names
methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
NCBI Official Symbol
MTHFD1L
NCBI Official Synonym Symbols
FTHFSDC1; MTC1THFS; dJ292B18.2; RP1-292B18.2
NCBI Protein Information
monofunctional C1-tetrahydrofolate synthase, mitochondrial; 10-formyl-THF synthetase; formyltetrahydrofolate synthetase domain containing 1
UniProt Protein Name
Monofunctional C1-tetrahydrofolate synthase, mitochondrial
UniProt Gene Name
MTHFD1L
UniProt Synonym Gene Names
FTHFSDC1
UniProt Entry Name
C1TM_HUMAN

NCBI Description

The protein encoded by this gene is involved in the synthesis of tetrahydrofolate (THF) in the mitochondrion. THF is important in the de novo synthesis of purines and thymidylate and in the regeneration of methionine from homocysteine. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

MTHFD1L: May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.4.3; Mitochondrial; Carbohydrate Metabolism - glyoxylate and dicarboxylate; Cofactor and Vitamin Metabolism - one carbon pool by folate; Ligase

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: mitochondrion; membrane; cytosol

Molecular Function: methylenetetrahydrofolate dehydrogenase (NADP+) activity; protein homodimerization activity; formate-tetrahydrofolate ligase activity; methenyltetrahydrofolate cyclohydrolase activity; ATP binding

Biological Process: tetrahydrofolate metabolic process; folic acid and derivative metabolic process; folic acid and derivative biosynthetic process; formate metabolic process; one-carbon compound metabolic process

Research Articles on MTHFD1L

Similar Products

Product Notes

The MTHFD1L mthfd1l (Catalog #AAA6011688) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTHFD1L (Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial, Formyltetrahydrofolate Synthetase, FTHFSDC1) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTHFD1L can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the MTHFD1L mthfd1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VFKTDTRAEI DLVCELAKRA GAFDAVPCYH WSVGGKGSVD LARAVREAAS KRSRFQFLYD VQVPIVDKIR TIAQAVYGAK DIELSPEAQA KIDRYTQQG*. It is sometimes possible for the material contained within the vial of "MTHFD1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.